HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Oligomerization of hepatitis C virus core protein is crucial for interaction with the cytoplasmic domain of E1 envelope protein. Oligomerization of hepatitis C virus core protein is crucial for interaction with the cytoplasmic domain of E1 envelope protein. J. Virol. (0022-538X) 2006 imex curation Nakai K., Okamoto T., Kimura-Someya T., Ishii K., Lim C.K., Tani H., Matsuo E., Abe T., Mori Y., Suzuki T., Miyamura T., Nunberg J.H., Moriishi K., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken.osaka-u.ac.jp 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Nakai K., Okamoto T., Kimura-Someya T., Ishii K., Lim C.K., Tani H., Matsuo E., Abe T., Mori Y., Suzuki T., Miyamura T., Nunberg J.H., Moriishi K., Matsuura Y. Virus - Publications including interactions involving viral proteins In the viral strain used by the authors, several key amino acid residues differ from those present in the sequences described in UniProt entry Q03463. These have been mapped as variants in order to correctly describe the effects of their mutation. matsuura@biken.osaka-u.ac.jp Accepted 2014-MAR-03 by ORCHARD J. Virol. (0022-538X) 2006 imex curation Oligomerization of hepatitis C virus core protein is crucial for interaction with the cytoplasmic domain of E1 envelope protein. Oligomerization of hepatitis C virus core protein is crucial for interaction with the cytoplasmic domain of E1 envelope protein. J. Virol. (0022-538X) 2006 imex curation Nakai K., Okamoto T., Kimura-Someya T., Ishii K., Lim C.K., Tani H., Matsuo E., Abe T., Mori Y., Suzuki T., Miyamura T., Nunberg J.H., Moriishi K., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken.osaka-u.ac.jp 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nakai K., Okamoto T., Kimura-Someya T., Ishii K., Lim C.K., Tani H., Matsuo E., Abe T., Mori Y., Suzuki T., Miyamura T., Nunberg J.H., Moriishi K., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken.osaka-u.ac.jp Accepted 2014-MAR-03 by ORCHARD J. Virol. (0022-538X) 2006 imex curation Oligomerization of hepatitis C virus core protein is crucial for interaction with the cytoplasmic domain of E1 envelope protein. Oligomerization of hepatitis C virus core protein is crucial for interaction with the cytoplasmic domain of E1 envelope protein. J. Virol. (0022-538X) 2006 imex curation Nakai K., Okamoto T., Kimura-Someya T., Ishii K., Lim C.K., Tani H., Matsuo E., Abe T., Mori Y., Suzuki T., Miyamura T., Nunberg J.H., Moriishi K., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken.osaka-u.ac.jp 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nakai K., Okamoto T., Kimura-Someya T., Ishii K., Lim C.K., Tani H., Matsuo E., Abe T., Mori Y., Suzuki T., Miyamura T., Nunberg J.H., Moriishi K., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken.osaka-u.ac.jp Accepted 2014-MAR-03 by ORCHARD J. Virol. (0022-538X) 2006 imex curation q03463-pro_0000278733 Envelope glycoprotein E1 protein protein hcvj1 Hepatitis C virus genotype 1b (isolate HC-J1) (HCV) YQVRNSTGLYHVTNDCPNSSIVYEAHDAILHTPGCVPCVREGNVSRCWVAMTPTVATRDGKLPATQLRRHIDLLVGSATLCSALYVGDLCGSVFLIGQLFTFSPRRHWTTQGCNCSIYPGHITGHRMAWDMMMNWSPTAALVMAQLLRIPQAILDMIAGAHWGVLAGIAYFSMVGNWAKVLVVLLLFAGVDA 192 383 64F57B8CD9B47E33 q03463-pro_0000278730 Core protein precursor protein protein hcvj1 Hepatitis C virus genotype 1b (isolate HC-J1) (HCV) STIPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKVRRPEGRTWAQPGYPWPLYGNEGCGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTVPASA 2 191 639F4DDBD6C6673D e1-core-3 2 5 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait n-terminal flag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 3B and 4B HCV core protein coprecipitated with FLAG-E1-HA in the presence of tRNA, little association was seen in the absence of tRNA e1-core-1 2 4 unspecified role unspecified role bait bait n-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 5B q03463_pro-q03463_pro-1 2 4 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey 4 competitor competitor competitor prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig. 5C e1-core-4 3 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 e1-core-2 1 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait Q03463-PRO_0000278733:p.Gly120_Thr123delinsAlaAlaAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain GHIT AAAA Wed May 02 16:25:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly_his_ile_thr120-123ala_ala_ala_ala' Tue Jun 30 15:56:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly120_Thr123delinsAlaAlaAlaAla' ile121val_thr122ser natural, standard, encoded residue natural, standard, encoded residue certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 6B