MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structural basis for molecular recognition and presentation of histone H3 by WDR5. Structural basis for molecular recognition and presentation of histone H3 by WDR5. EMBO J. (0261-4189) 2006 imex curation Schuetz A., Allali-Hassani A., Martín F., Loppnau P., Vedadi M., Bochkarev A., Plotnikov AN., Arrowsmith CH., Min J. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schuetz A., Allali-Hassani A., Martín F., Loppnau P., Vedadi M., Bochkarev A., Plotnikov AN., Arrowsmith CH., Min J. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Structural basis for molecular recognition and presentation of histone H3 by WDR5. Structural basis for molecular recognition and presentation of histone H3 by WDR5. EMBO J. (0261-4189) 2006 imex curation Schuetz A., Allali-Hassani A., Martín F., Loppnau P., Vedadi M., Bochkarev A., Plotnikov AN., Arrowsmith CH., Min J. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Schuetz A., Allali-Hassani A., Martín F., Loppnau P., Vedadi M., Bochkarev A., Plotnikov AN., Arrowsmith CH., Min J. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Structural basis for molecular recognition and presentation of histone H3 by WDR5. Structural basis for molecular recognition and presentation of histone H3 by WDR5. EMBO J. (0261-4189) 2006 imex curation Schuetz A., Allali-Hassani A., Martín F., Loppnau P., Vedadi M., Bochkarev A., Plotnikov AN., Arrowsmith CH., Min J. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Schuetz A., Allali-Hassani A., Martín F., Loppnau P., Vedadi M., Bochkarev A., Plotnikov AN., Arrowsmith CH., Min J. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation h31_human Histone H3.1 H3FA H3FL H3FD H3FI H3FH H3FK H3FF H3FJ H3FB Histone H3/a Histone H3/b Histone H3/c Histone H3/d Histone H3/f Histone H3/h Histone H3/i Histone H3/j Histone H3/k Histone H3/l H3C1 HIST1H3A H3C2 HIST1H3B H3C3 H3FC HIST1H3C H3C4 HIST1H3D H3C6 HIST1H3E H3C7 HIST1H3F H3C8 HIST1H3G H3C10 HIST1H3H H3C11 HIST1H3I H3C12 HIST1H3J protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA DIP protein P68431 original sequence version: 78 DIP protein P68431 original sequence version: 79 DIP protein P68431 original sequence version: 76 DIP protein P68431 original sequence version: 92 DIP protein P68431 original sequence version: 87 DIP protein P68431 original sequence version: 101 DIP protein P68431 original sequence version: 130 DIP protein P68431 original sequence version: 115 9B89008EA50A0EF6 wdr5_human WD repeat-containing protein 5 BMP2-induced 3-kb gene protein WDR5 BIG3 protein protein human Homo sapiens Human MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC DIP protein P61964 original sequence version: 35 DIP protein P61964 original sequence version: 131 DIP protein P61964 original sequence version: 83 DIP protein P61964 original sequence version: 84 DIP protein P61964 original sequence version: 87 DIP protein P61964 original sequence version: 116 DIP protein P61964 original sequence version: 130 DIP protein P61964 original sequence version: 113 DIP protein P61964 original sequence version: 112 DIP protein P61964 original sequence version: 99 4BF30914A2250286 hist1h3b-wdr5 1 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-3293321: original sequence: 1-6 : MARTKQTARKSTGGK methylatedlysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain range MINT-3293323: original sequence: 4-4 : MARTKQTARKSTG Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 direct interaction direct interaction F3 F4 F5 F2 EMBO-Journal homomint mint wdr5-hist1h3b 3 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-3293351: original sequence: 1-11 : MARTKQTARK Stoichiometry: 1.0 direct interaction direct interaction F7 F6 EMBO-Journal kd 35 micromolar homomint mint wdr5-hist1h3b-1 3 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-3319266: original sequence: 1-11 : MARTKQTARK methylatedlysine melys methylated lysine MeLys certain certain sequence position certain certain certain sequence position certain range MINT-3319313: original sequence: 4-4 : MARTKQTARKSTG Stoichiometry: 1.0 direct interaction direct interaction F7 F6 EMBO-Journal kd 77 micromolar homomint mint wdr5-hist1h3b-2 3 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified methylatedlysine n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain range MINT-3319469: original sequence: 4-4 : MARTKQTARKSTG binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-3319467: original sequence: 1-11 : MARTKQTARK Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F7 F6 EMBO-Journal kd 192 micromolar homomint mint wdr5-hist1h3b-3 3 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified methylatedlysine n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain range MINT-3319495: original sequence: 4-4 : MARTKQTARKSTG binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-3319493: original sequence: 1-11 : MARTKQTARK Stoichiometry: 1.0 direct interaction direct interaction F7 F6 EMBO-Journal kd 115 micromolar homomint mint hist1h3b-wdr5-1 2 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-3293382: original sequence: 1-11 : MARTKQTARK Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-3369691: original sequence: 24-334 : TQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD Stoichiometry: 1.0 direct interaction direct interaction F8 EMBO-Journal kd 0.9 nanomolar homomint mint hist1h3b-wdr5-2 2 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified methylatedlysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain range MINT-3319424: original sequence: 4-4 : MARTKQTARKSTG binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-3319359: original sequence: 1-11 : MARTKQTARK Stoichiometry: 1.0 direct interaction direct interaction F8 EMBO-Journal kd 264 nanomolar homomint mint hist1h3b-wdr5-3 2 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-3319532: original sequence: 1-8 : MARTKQTARKSTGGKAP methylatedlysine melys methylated lysine MeLys certain certain sequence position certain certain certain sequence position certain range MINT-3319534: original sequence: 4-4 : MARTKQTARKSTG Stoichiometry: 1.0 direct interaction direct interaction F8 EMBO-Journal kd 40 nanomolar homomint mint hist1h3b-wdr5-4 2 4 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-3319562: original sequence: 1-11 : MARTKQTARK methylatedlysine n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain range MINT-3319564: original sequence: 4-4 : MARTKQTARKSTG Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F8 EMBO-Journal kd 32,8 nanomolar homomint mint