MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The UL144 gene product of human cytomegalovirus activates NFkappaB via a TRAF6-dependent mechanism. The UL144 gene product of human cytomegalovirus activates NFkappaB via a TRAF6-dependent mechanism. EMBO J. (0261-4189) 2006 imex curation Poole E., King CA., Sinclair JH., Alcami A. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions human-u373 Homo sapiens u373 u373 anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Poole E., King CA., Sinclair JH., Alcami A. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation The UL144 gene product of human cytomegalovirus activates NFkappaB via a TRAF6-dependent mechanism. The UL144 gene product of human cytomegalovirus activates NFkappaB via a TRAF6-dependent mechanism. EMBO J. (0261-4189) 2006 imex curation Poole E., King CA., Sinclair JH., Alcami A. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions human-u373 Homo sapiens u373 u373 fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Poole E., King CA., Sinclair JH., Alcami A. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation The UL144 gene product of human cytomegalovirus activates NFkappaB via a TRAF6-dependent mechanism. The UL144 gene product of human cytomegalovirus activates NFkappaB via a TRAF6-dependent mechanism. EMBO J. (0261-4189) 2006 imex curation Poole E., King CA., Sinclair JH., Alcami A. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions human-u373 Homo sapiens u373 u373 imaging technique imaging technique microscopy experimental particp experimental participant identification experimental particp Poole E., King CA., Sinclair JH., Alcami A. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation q8v2d1_hcmv protein protein hhv-5 Human cytomegalovirus HHV-5 Human herpesvirus 5 MKPLIMLICFAVILLQLGVTKVCQHNEVQLGNECCPPCGSGQRVTKVCTDYTSVTCTPCPNGTYVSGLYNCTDCTQCNVTQVMIRNCTSTNNTVCAPKNHTYFPTPGVHHKQRQQNHTAHITVKQGKSGRHTLAWLSLFIFLVGIILLILYLIAAYRSERCQQCCSIGKIFYRTL mint 75C7586833785585 traf6_human TNF receptor-associated factor 6 TRAF6 RNF85 Interleukin-1 signal transducer RING finger protein 85 E3 ubiquitin-protein ligase TRAF6 RING-type E3 ubiquitin transferase TRAF6 protein protein human Homo sapiens Human MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV DIP protein Q9Y4K3 original sequence version: 154 DIP protein Q9Y4K3 original sequence version: 91 DIP protein Q9Y4K3 original sequence version: 114 DIP protein Q9Y4K3 original sequence version: 118 DIP protein Q9Y4K3 original sequence version: 140 DIP protein Q9Y4K3 original sequence version: 159 DIP protein Q9Y4K3 original sequence version: 132 DIP protein Q9Y4K3 original sequence version: 158 DIP protein Q9Y4K3 original sequence version: 171 DIP protein Q9Y4K3 original sequence version: 117 DIP protein Q9Y4K3 original sequence version: 113 5AB9C255CCFEE749 q8v2d1-traf6 3 4 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell t7 tagged t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Stoichiometry: 1.0 colocalization colocalization F4A F4B homomint mint q8v2d1-traf6-1 2 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed living cell living cell t7 tagged t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 proximity proximity close-contact colocalization neighbourhood interaction F4C F4D EMBO-Journal homomint mint q8v2d1-traf6-2 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell t7 tagged t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F5 EMBO-Journal homomint mint