IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Crystal structure and mechanistic determinants of SARS coronavirus nonstructural protein 15 define an endoribonuclease family. Crystal structure and mechanistic determinants of SARS coronavirus nonstructural protein 15 define an endoribonuclease family. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ricagno S., Egloff MP., Ulferts R., Coutard B., Nurizzo D., Campanacci V., Cambillau C., Ziebuhr J., Canard B. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus bruno.canard@afmb.univ-mrs.fr Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ricagno S., Egloff MP., Ulferts R., Coutard B., Nurizzo D., Campanacci V., Cambillau C., Ziebuhr J., Canard B. Virus - Publications including interactions involving viral proteins Ref. 23 states that the Frankfurt-1 strain; NCBI accession No. AY291315 was used; the sequence is identical to that of P0C6X7 PRO_0000037321. Supporting Figure 5 text states that "the SARS-CoV NendoU mutant, nsp15_V291G/D300G, which was used for crystallization and structure analysis.". bruno.canard@afmb.univ-mrs.fr Accepted 2020-MAY-08 AT 05:21 BST AT 05:21 BST by KALPANAP Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Crystal structure and mechanistic determinants of SARS coronavirus nonstructural protein 15 define an endoribonuclease family. Crystal structure and mechanistic determinants of SARS coronavirus nonstructural protein 15 define an endoribonuclease family. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ricagno S., Egloff MP., Ulferts R., Coutard B., Nurizzo D., Campanacci V., Cambillau C., Ziebuhr J., Canard B. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus bruno.canard@afmb.univ-mrs.fr Only protein-protein interactions imex curation in vitro In vitro nuclease assay nuclease assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ricagno S., Egloff MP., Ulferts R., Coutard B., Nurizzo D., Campanacci V., Cambillau C., Ziebuhr J., Canard B. Virus - Publications including interactions involving viral proteins Ref. 23 states that the Frankfurt-1 strain; NCBI accession No. AY291315 was used; the sequence is identical to that of P0C6X7 PRO_0000037321. Supporting Figure 5 text states that "the SARS-CoV NendoU mutant, nsp15_V291G/D300G, which was used for crystallization and structure analysis.". bruno.canard@afmb.univ-mrs.fr Accepted 2020-MAY-08 AT 05:21 BST AT 05:21 BST by KALPANAP Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation p0c6x7-pro_0000037321 Uridylate-specific endoribonuclease nsp15 rep ORF1ab polyprotein 1a-1b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus SLENVAYNVVNKGHFDGHAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKRNIKPVPEIKILNNLGVDIAANTVIWDYKREAPAHVSTIGVCTMTDIAKKPTESACSSLTVLFDGRVEGQVDLFRNARNGVLITEGSVKGLTPSKGPAQASVNGVTLIGESVKTQFNYFKKVDGIIQQLPETYFTQSRDLEDFKPRSQMETDFLELAMDEFIQRYKLEGYAFEHIVYGDFSHGQLGGLHLMIGLAKRSQDSPLKLEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVISKVVKVTIDYAEISFMLWCKDGHVETFYPKLQ 6430 6775 31BD15E3D0B70C6D rna2 rna ribonucleic acid RNA rna chemical synthesis Chemical synthesis (Chemical synthesis) CGCAGUGAGCUCCUAAUCGCCC rep-87 1 3 unspecified role unspecified role neutral component neutral component purified purified P0C6X7-PRO_0000037321:p.[Val291Gly;Asp300Gly] mutation mutation certain certain sequence position certain certain certain sequence position certain V G certain certain sequence position certain certain certain sequence position certain D G Tue Jun 30 17:05:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val291Gly;Asp300Gly]' ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 1 rep-88 2 4 enzyme target enzyme target substrate substrate neutral component neutral component 5' label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 enzyme enzyme neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P0C6X7-PRO_0000037321:p.[Val291Gly;Asp300Gly] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V G certain certain sequence position certain certain certain sequence position certain D G Tue Jun 30 20:23:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val291Gly;Asp300Gly]' P0C6X7-PRO_0000037321:p.Ser293Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 19:59:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser293Ala' P0C6X7-PRO_0000037321:p.Thr340Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain T A Mon Jun 29 10:01:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.thr340Ala' Tue Jun 30 18:55:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr340Ala' P0C6X7-PRO_0000037321:p.Tyr342Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain Y A Tue Jun 30 17:01:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr342Ala' P0C6X7-PRO_0000037321:p.Pro343Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain P A Tue Jun 30 19:33:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro343Ala' ecoli Escherichia coli (strain K12) ncl acid cleavage nucleic acid cleavage ncl acid cleavage Supporting Figure 5 and 6