HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Interaction of hepatitis C virus F protein with prefoldin 2 perturbs tubulin cytoskeleton organization. Interaction of hepatitis C virus F protein with prefoldin 2 perturbs tubulin cytoskeleton organization. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Tsao M.L., Chao C.H., Yeh C.T. Virus - Publications including interactions involving viral proteins They cloned PF2L from liver mRNA sold by invitrogen. Invitrogen catalog only offer human liver mRNA. chauting@adm.cgmh.org.tw Only protein-protein interactions chlae-vero Chlorocebus (Cercopithecus) aethiops kidney cells Grivet vero Chlorocebus (Cercopithecus) aethiops kidney cells similar to cos-7 cells but these are not trasnformed confocal microscopy confocal microscopy immunostaining immunostaining Tsao M.L., Chao C.H., Yeh C.T. Virus - Publications including interactions involving viral proteins They cloned PF2L from liver mRNA sold by invitrogen. Invitrogen catalog only offer human liver mRNA. chauting@adm.cgmh.org.tw Accepted 2015-MAR-04 by PPORRAS Biochem. Biophys. Res. Commun. (0006-291X) 2006 Only protein-protein interactions imex curation Interaction of hepatitis C virus F protein with prefoldin 2 perturbs tubulin cytoskeleton organization. Interaction of hepatitis C virus F protein with prefoldin 2 perturbs tubulin cytoskeleton organization. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Tsao M.L., Chao C.H., Yeh C.T. Virus - Publications including interactions involving viral proteins They cloned PF2L from liver mRNA sold by invitrogen. Invitrogen catalog only offer human liver mRNA. chauting@adm.cgmh.org.tw Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Tsao M.L., Chao C.H., Yeh C.T. Virus - Publications including interactions involving viral proteins chauting@adm.cgmh.org.tw Accepted 2015-MAR-04 by PPORRAS Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Interaction of hepatitis C virus F protein with prefoldin 2 perturbs tubulin cytoskeleton organization. Interaction of hepatitis C virus F protein with prefoldin 2 perturbs tubulin cytoskeleton organization. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Tsao M.L., Chao C.H., Yeh C.T. Virus - Publications including interactions involving viral proteins They cloned PF2L from liver mRNA sold by invitrogen. Invitrogen catalog only offer human liver mRNA. chauting@adm.cgmh.org.tw Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tsao M.L., Chao C.H., Yeh C.T. Virus - Publications including interactions involving viral proteins chauting@adm.cgmh.org.tw Accepted 2015-FEB-27 by PPORRAS Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Interaction of hepatitis C virus F protein with prefoldin 2 perturbs tubulin cytoskeleton organization. Interaction of hepatitis C virus F protein with prefoldin 2 perturbs tubulin cytoskeleton organization. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Tsao M.L., Chao C.H., Yeh C.T. Virus - Publications including interactions involving viral proteins They cloned PF2L from liver mRNA sold by invitrogen. Invitrogen catalog only offer human liver mRNA. chauting@adm.cgmh.org.tw Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Tsao M.L., Chao C.H., Yeh C.T. Virus - Publications including interactions involving viral proteins chauting@adm.cgmh.org.tw Accepted 2015-FEB-27 by PPORRAS Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation f_hcv77 F protein Alternate reading frame protein/F-protein Frameshifted protein p16 p17 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) MSTNPKPQRKKPNVTPTVAHRTSSSRVAVRSLVEFTCCRAGALDWVCARRGRLPSGRNLEVDVSLSPRHVGPRAGPGLSPGTLGPSMAMRVAGGRDGSCLPVALGLAGAPQTPGVGRAIWVRSSIPLRAASPTSWGTYRSSAPLLEALPGPWRMASGFWKTA AE9D5391D19211B6 pfd2_human Prefoldin subunit 2 HSPC231 PFDN2 PFD2 protein protein human Homo sapiens Human MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS 2FC68A7425412198 pfd1_human Prefoldin subunit 1 PFDN1 PFD1 protein protein human Homo sapiens Human MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ 4C88216612864F87 f-pfdn2 4 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association No figure f-pfdn2-1 2 6 unspecified role unspecified role bait bait v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey egfp tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1B f-pfdn2-2 1 5 unspecified role unspecified role neutral component neutral component gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 2B pfdn2-pfd1 3 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait 5 inhibitor inhibitor unspecified role unspecified role physical association physical association 3B pfdn2-pfdn1 3 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 3B