MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it E5 protein of human papillomavirus 16 downregulates HLA class I and interacts with the heavy chain via its first hydrophobic domain. E5 protein of human papillomavirus 16 downregulates HLA class I and interacts with the heavy chain via its first hydrophobic domain. Int. J. Cancer (0020-7136) 2006 rapid curation Ashrafi GH., Haghshenas M., Marchetti B., Campo MS. Virus - Publications including interactions involving viral proteins manually identified rapid curation unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Ashrafi GH., Haghshenas M., Marchetti B., Campo MS. Virus - Publications including interactions involving viral proteins manually identified manually identified Int. J. Cancer (0020-7136) 2006 rapid curation rapid curation ve5_hpv16 Probable protein E5 E5 protein protein hpv16 Human papillomavirus type 16 MTNLDTASTTLLACFLLCFCVLLCVCLLIRPLLLSVSTYTSLIILVLLLWITAASAFRCFIVYIIFVYIPLFLIHTHARFLIT mint 442C0ABF0D77CDCF 1a01_human HLA class I histocompatibility antigen, A-1 alpha chain HLA-A HLAA Human leukocyte antigen A*01 HLA HLA-A*0101 protein protein human Homo sapiens Human MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV This interactor won't be updated using Uniprot. mint Involved in the presentation of foreign antigens to the immune system 8667AFF3F06C4932 hla_a-e5 1 2 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association F1 F4 homomint mint