HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Bovine herpesvirus 1 UL49.5 protein inhibits the transporter associated with antigen processing despite complex formation with glycoprotein M. Bovine herpesvirus 1 UL49.5 protein inhibits the transporter associated with antigen processing despite complex formation with glycoprotein M. Journal of virology 2006 imex curation Lipińska AD., Koppers-Lalic D., Rychłowski M., Admiraal P., Rijsewijk FA., Bieńkowska-Szewczyk K., Wiertz EJ. Virus - Publications including interactions involving viral proteins Since no UniProt entries exist for the BHV1 strain Lam (genotype 1.1) used in the study, the reference cooper strain (genotype 1.1) protein accessions Q77CE4 (GN_BHV1C) and P52370 (GM_BHV1C) have been used instead. wiertz@lumc.nl 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-mel_juso Homo sapiens mel_juso anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lipińska AD., Koppers-Lalic D., Rychłowski M., Admiraal P., Rijsewijk FA., Bieńkowska-Szewczyk K., Wiertz EJ. Virus - Publications including interactions involving viral proteins Since no UniProt entries exist for the BHV1 strain Lam (genotype 1.1) used in the study, the reference cooper strain (genotype 1.1) protein accessions Q77CE4 (GN_BHV1C) and P52370 (GM_BHV1C) have been used instead. wiertz@lumc.nl Accepted 2015-NOV-09 AT 09:32 GMT AT 09:32 GMT by MGT Journal of virology 2006 imex curation gn_bhv1c Envelope glycoprotein N gN UL49.5 protein protein bhv1c Bovine herpesvirus 1.1 (strain Cooper) BoHV-1 Infectious bovine rhinotracheitis virus MPRSPLIVAVVAAALFAIVRGRDPLLDAMRREGAMDFWSAGCYARGVPLSEPPQALVVFYVALTAVMVAVALYAYGLCFRLMGASGPNKKESRGRG gm_bhv1c Envelope glycoprotein M protein protein Bovine herpesvirus 1 Bovine herpesvirus 1 gm-gn-1 1 2 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association 1B gm_bhv1c-gn_bhv1c_1-1 1 2 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association 1B