MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Mutual regulation of c-Jun and ATF2 by transcriptional activation and subcellular localization. Mutual regulation of c-Jun and ATF2 by transcriptional activation and subcellular localization. EMBO J. (0261-4189) 2006 imex curation Liu H., Deng X., Shyu YJ., Li JJ., Taparowsky EJ., Hu CD. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 complementation protein complementation assay PCA complementation nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Liu H., Deng X., Shyu YJ., Li JJ., Taparowsky EJ., Hu CD. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation junb_human Transcription factor jun-B JUNB protein protein human Homo sapiens Human MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF DIP protein P17275 original sequence version: 151 DIP protein P17275 original sequence version: 118 DIP protein P17275 original sequence version: 143 DF8CD1CD4409C6BE atf2_human Cyclic AMP-dependent transcription factor ATF-2 ATF2 CREB2 CREBP1 Activating transcription factor 2 cAMP response element-binding protein CRE-BP1 HB16 Cyclic AMP-responsive element-binding protein 2 protein protein human Homo sapiens Human MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEPALSQIVMAPSSQSQPSGS 0190EEFAEC8891A7 fos_human Proto-oncogene c-Fos Cellular oncogene fos G0/G1 switch regulatory protein 7 FOS G0S7 protein protein human Homo sapiens Human MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL DIP protein P01100 original sequence version: 99 DIP protein P01100 original sequence version: 166 DIP protein P01100 original sequence version: 186 DIP protein P01100 original sequence version: 156 9E3B2969347C90C8 fos-junb-1 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1A EMBO-Journal we expressed c-Fos, c-Jun and ATF2 as fusion proteins with either VN173 or VC155 in COS-1 cells. Although fluorescent signals derived from JunVN173 FosVC155 and JunVN173 JunVC155 were localized, as predicted, in the nucleus (Figure 1A and B), 90% of fluorescent signals derived from ATF2VN173 ATF2VC155 were located in the cytoplasm. Interestingly, we observed that the BiFC signals derived from JunVN173 ATF2VC155 were located equally in the cytoplasm and the nucleus, whereas the majority of JunYN155 ATF2YC155 was localized in the cytoplasm when YFP fragments were used (Hu et al, 2002). homomint mint junb-junb 1 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1A EMBO-Journal we expressed c-Fos, c-Jun and ATF2 as fusion proteins with either VN173 or VC155 in COS-1 cells. Although fluorescent signals derived from JunVN173 FosVC155 and JunVN173 JunVC155 were localized, as predicted, in the nucleus (Figure 1A and B), 90% of fluorescent signals derived from ATF2VN173 ATF2VC155 were located in the cytoplasm. Interestingly, we observed that the BiFC signals derived from JunVN173 ATF2VC155 were located equally in the cytoplasm and the nucleus, whereas the majority of JunYN155 ATF2YC155 was localized in the cytoplasm when YFP fragments were used (Hu et al, 2002). homomint mint atf2-junb 1 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1A EMBO-Journal we expressed c-Fos, c-Jun and ATF2 as fusion proteins with either VN173 or VC155 in COS-1 cells. Although fluorescent signals derived from JunVN173 FosVC155 and JunVN173 JunVC155 were localized, as predicted, in the nucleus (Figure 1A and B), 90% of fluorescent signals derived from ATF2VN173 ATF2VC155 were located in the cytoplasm. Interestingly, we observed that the BiFC signals derived from JunVN173 ATF2VC155 were located equally in the cytoplasm and the nucleus, whereas the majority of JunYN155 ATF2YC155 was localized in the cytoplasm when YFP fragments were used (Hu et al, 2002). homomint mint atf2-atf2 1 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1A EMBO-Journal we expressed c-Fos, c-Jun and ATF2 as fusion proteins with either VN173 or VC155 in COS-1 cells. Although fluorescent signals derived from JunVN173 FosVC155 and JunVN173 JunVC155 were localized, as predicted, in the nucleus (Figure 1A and B), 90% of fluorescent signals derived from ATF2VN173 ATF2VC155 were located in the cytoplasm. Interestingly, we observed that the BiFC signals derived from JunVN173 ATF2VC155 were located equally in the cytoplasm and the nucleus, whereas the majority of JunYN155 ATF2YC155 was localized in the cytoplasm when YFP fragments were used (Hu et al, 2002). homomint mint