MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Regulation of MDMX nuclear import and degradation by Chk2 and 14-3-3. Regulation of MDMX nuclear import and degradation by Chk2 and 14-3-3. EMBO J. (0261-4189) 2006 imex curation LeBron C., Chen L., Gilkes DM., Chen J. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined LeBron C., Chen L., Gilkes DM., Chen J. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Regulation of MDMX nuclear import and degradation by Chk2 and 14-3-3. Regulation of MDMX nuclear import and degradation by Chk2 and 14-3-3. EMBO J. (0261-4189) 2006 imex curation LeBron C., Chen L., Gilkes DM., Chen J. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined LeBron C., Chen L., Gilkes DM., Chen J. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Regulation of MDMX nuclear import and degradation by Chk2 and 14-3-3. Regulation of MDMX nuclear import and degradation by Chk2 and 14-3-3. EMBO J. (0261-4189) 2006 imex curation LeBron C., Chen L., Gilkes DM., Chen J. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined LeBron C., Chen L., Gilkes DM., Chen J. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Regulation of MDMX nuclear import and degradation by Chk2 and 14-3-3. Regulation of MDMX nuclear import and degradation by Chk2 and 14-3-3. EMBO J. (0261-4189) 2006 imex curation LeBron C., Chen L., Gilkes DM., Chen J. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined LeBron C., Chen L., Gilkes DM., Chen J. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Regulation of MDMX nuclear import and degradation by Chk2 and 14-3-3. Regulation of MDMX nuclear import and degradation by Chk2 and 14-3-3. EMBO J. (0261-4189) 2006 imex curation LeBron C., Chen L., Gilkes DM., Chen J. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined LeBron C., Chen L., Gilkes DM., Chen J. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation kc1a_human Casein kinase I isoform alpha CSNK1A1 CK1 protein protein human Homo sapiens Human MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF DIP protein P48729 original sequence version: 92 DIP protein P48729 original sequence version: 171 DIP protein P48729 original sequence version: 163 1B2085AE33CAFAC2 1433e_human 14-3-3 protein epsilon YWHAE protein protein human Homo sapiens Human MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ DIP protein P62258 original sequence version: 130 DIP protein P62258 original sequence version: 132 DIP protein P62258 original sequence version: 91 07817CCBD1F75B26 ima4_human Importin subunit alpha-4 KPNA3 QIP2 Karyopherin subunit alpha-3 SRP1-gamma Importin alpha Q2 protein protein human Homo sapiens Human MAENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDVDADFKAQNVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVKCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVQSNAVPLFLRLLRSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVIVNLCRNKDPPPPMETVQEILPALCVLIYHTDINILVDTVWALSYLTDGGNEQIQMVIDSGVVPFLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPCLIPEATQGGTYNFDPTANLQTKEFNF DIP protein O00505 original sequence version: 107 C4FF132C3F346B7F 1433g_human 14-3-3 protein gamma YWHAG Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN DIP protein P61981 original sequence version: 126 DIP protein P61981 original sequence version: 135 B0D16C6DE1F4455D mdm4_human Protein Mdm4 MDM4 MDMX p53-binding protein Mdm4 Mdm2-like p53-binding protein Protein Mdmx Double minute 4 protein protein protein human Homo sapiens Human MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTDAAQTLALAQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLPTSEHKCIHSREDEDLIENLAQDETSRLDLGFEEWDVAGLPWWFLGNLRSNYTPRSNGSTDLQTNQDVGTAIVSDTTDDLWFLNESVSEQLGVGIKVEAADTEQTSEEVGKVSDKKVIEVGKNDDLEDSKSLSDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVPDCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQRTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA DIP protein O15151 original sequence version: 141 DIP protein O15151 original sequence version: 109 DIP protein O15151 original sequence version: 129 DIP protein O15151 original sequence version: 147 415E6FA5A0C69857 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN DIP protein P31946 original sequence version: 171 DIP protein P31946 original sequence version: 97 DIP protein P31946 original sequence version: 119 DIP protein P31946 original sequence version: 122 DIP protein P31946 original sequence version: 180 6BE1A9BF97468017 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63104 original sequence version: 144 D464DF2286BBFE60 1433t_human 14-3-3 protein theta YWHAQ 14-3-3 protein tau 14-3-3 protein T-cell Protein HS1 protein protein human Homo sapiens Human MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN DIP protein P27348 original sequence version: 164 DIP protein P27348 original sequence version: 173 175534325E9E37C4 1433f_human 14-3-3 protein eta YWHAH YWHA1 Protein AS1 protein protein human Homo sapiens Human MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN DIP protein Q04917 original sequence version: 166 DIP protein Q04917 original sequence version: 168 DIP protein Q04917 original sequence version: 175 D70FBC100C45D6E5 q3yba8_human protein protein human Homo sapiens Human MEKTELIQKAKLAERYDDMATCMKAGTKQGAELSKEERNLLSVAYKNVVGAAGPPGASSGASSRIPTPPTRSCS mint homomint 57F6F5655A97CEA8 mdm4-csnk1a1-1 3 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1A EMBO-Journal HeLa cells were stably transfected with FLAG-tagged MDMX. When FLAG-MDMX was purified by immunoprecipitation, two proteins reproducibly copurified with MDMX (Figure 1A). Peptide sequencing by mass spectrometry determined the 34 kDa protein as casein kinase 1 alpha, and the 24 kDa protein as 14-3-3tau isoform. homomint mint mdm4-q3yba8 3 15 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1A EMBO-Journal HeLa cells were stably transfected with FLAG-tagged MDMX. When FLAG-MDMX was purified by immunoprecipitation, two proteins reproducibly copurified with MDMX (Figure 1A). Peptide sequencing by mass spectrometry determined the 34 kDa protein as casein kinase 1 alpha, and the 24 kDa protein as 14-3-3tau isoform. homomint domino mint mdm4-q3yba8-1 4 15 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1B EMBO-Journal Endogenous MDMX interaction with 14-3-3 was nearly below our detection limit in the absence of stress. However, DNA-damaging treatments with camptothecin or ionizing irradiation significantly stimulated MDMX 14-3-3tau binding (Figure 1B). Interaction increases when cells are treated with WCE. homomint domino mint q3yba8-mdm4 1 15 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 10 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 physical association physical association F1C EMBO-Journal To determine whether MDMX also interacts with other 14-3-3 isoforms, MDMX was cotransfected with the entire 14-3-3 panel (tau, sigma, beta, gamma, zeta, alt epsilon, eta). The epitope tagged 14-3-3 was immunoprecipitated and the co-precipitated MDMX was detected by Western blot. The results showed absence of binding to 14-3-3sigma, weak binding to gamma, and strong binding to tau, beta, zeta, alt epsilon, and eta (Figure 1C). homomint domino mint ywhab-mdm4 1 11 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 10 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 physical association physical association F1C EMBO-Journal To determine whether MDMX also interacts with other 14-3-3 isoforms, MDMX was cotransfected with the entire 14-3-3 panel (tau, sigma, beta, gamma, zeta, alt epsilon, eta). The epitope tagged 14-3-3 was immunoprecipitated and the co-precipitated MDMX was detected by Western blot. The results showed absence of binding to 14-3-3sigma, weak binding to gamma, and strong binding to tau, beta, zeta, alt epsilon, and eta (Figure 1C). homomint domino mint ywhae-mdm4 1 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell his tagged his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 10 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 physical association physical association F1C EMBO-Journal To determine whether MDMX also interacts with other 14-3-3 isoforms, MDMX was cotransfected with the entire 14-3-3 panel (tau, sigma, beta, gamma, zeta, alt epsilon, eta). The epitope tagged 14-3-3 was immunoprecipitated and the co-precipitated MDMX was detected by Western blot. The results showed absence of binding to 14-3-3sigma, weak binding to gamma, and strong binding to tau, beta, zeta, alt epsilon, and eta (Figure 1C). homomint domino mint ywhaz-mdm4 1 10 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 12 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1C EMBO-Journal To determine whether MDMX also interacts with other 14-3-3 isoforms, MDMX was cotransfected with the entire 14-3-3 panel (tau, sigma, beta, gamma, zeta, alt epsilon, eta). The epitope tagged 14-3-3 was immunoprecipitated and the co-precipitated MDMX was detected by Western blot. The results showed absence of binding to 14-3-3sigma, weak binding to gamma, and strong binding to tau, beta, zeta, alt epsilon, and eta (Figure 1C). homomint domino mint ywhah-mdm4 1 14 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell his tagged his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 10 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 physical association physical association F1C EMBO-Journal To determine whether MDMX also interacts with other 14-3-3 isoforms, MDMX was cotransfected with the entire 14-3-3 panel (tau, sigma, beta, gamma, zeta, alt epsilon, eta). The epitope tagged 14-3-3 was immunoprecipitated and the co-precipitated MDMX was detected by Western blot. The results showed absence of binding to 14-3-3sigma, weak binding to gamma, and strong binding to tau, beta, zeta, alt epsilon, and eta (Figure 1C). homomint domino mint ywhag-mdm4 1 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 10 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 physical association physical association F1C EMBO-Journal To determine whether MDMX also interacts with other 14-3-3 isoforms, MDMX was cotransfected with the entire 14-3-3 panel (tau, sigma, beta, gamma, zeta, alt epsilon, eta). The epitope tagged 14-3-3 was immunoprecipitated and the co-precipitated MDMX was detected by Western blot. The results showed absence of binding to 14-3-3sigma, weak binding to gamma, and strong binding to tau, beta, zeta, alt epsilon, and eta (Figure 1C). homomint domino mint q3yba8-mdm4-1 1 15 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 10 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell O15151:p.Ser367Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:10:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:50:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser367ala' Tue Jun 30 18:29:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser367Ala' range MINT-1958647: original sequence: 367-367 : NDVPDCRRTISAPVVRPKDA O15151:p.Pro369Ser mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P S Tue Jul 12 10:51:43 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:32:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro369ser' Tue Jun 30 18:12:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro369Ser' range MINT-1958650: original sequence: 369-369 : VPDCRRTISAPVVRPKDAYI Stoichiometry: 1.0 physical association physical association F2B EMBO-Journal The MDMX mutants were coexpressed with FLAG-14-3-3tau in H1299 cells and analyzed by anti-FLAG IP followed by MDMX Western blot. The results showed that MDMX binding to 14-3-3 was abrogated by the S367A mutation and significantly reduced by P369S mutation (Figure 2B). homomint domino mint mdm4-q3yba8-2 2 15 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain range MINT-2789388: original sequence: 367-367 : NDVPDCRRTISAPVVRPKDA binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1958691: original sequence: 364-372 : NEGNDVPDCRRTISAPVVRPKDAYIKKE Stoichiometry: 1.0 physical association physical association F2C EMBO-Journal The result showed that peptide with phosphorylated S367 specifically captured 14-3-3tau from the extract. Unphosphorylated S367 peptide, phosphorylated or unphosphorylated S342 peptides showed no binding above background noise (Figure 2C). The result showed that peptide with phosphorylated S367 specifically captured 14-3-3tau from the extract. homomint domino mint kpna3-mdm4 2 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 10 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate O15151:p.Lys468Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Tue Jul 12 10:08:10 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:01:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys468glu' Tue Jun 30 16:57:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys468Glu' range MINT-1958715: original sequence: 468-468 : VTCFHCARRLKKAGASCPIC Stoichiometry: 1.0 physical association physical association F7C EMBO-Journal When GST-importin alpha1, 3, 5, 6, and 7 fusion proteins were incubated with cell lysate containing MDMX, importin alpha3 showed significant binding to MDMX (Liu et al, 2005), which was abrogated by the K468E mutation (Figure 7C). homomint mint mdm4-ywhaq 5 1433T_HUMAN 13 unspecified role unspecified role unspecified role unspecified role MDM4_HUMAN 10 unspecified role unspecified role unspecified role unspecified role association association homomint domino mint