MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Interaction of F1L with the BH3 domain of Bak is responsible for inhibiting vaccinia-induced apoptosis. Interaction of F1L with the BH3 domain of Bak is responsible for inhibiting vaccinia-induced apoptosis. Cell Death Differ. (1350-9047) 2006 rapid curation Postigo A., Cross JR., Downward J., Way M. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown chromatography chromatography technology column chromatography chromatography predetermined predetermined participant predetermined Postigo A., Cross JR., Downward J., Way M. Virus - Publications including interactions involving viral proteins suggested by panni Cell Death Differ. (1350-9047) 2006 rapid curation rapid curation Interaction of F1L with the BH3 domain of Bak is responsible for inhibiting vaccinia-induced apoptosis. Interaction of F1L with the BH3 domain of Bak is responsible for inhibiting vaccinia-induced apoptosis. Cell Death Differ. (1350-9047) 2006 rapid curation Postigo A., Cross JR., Downward J., Way M. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown peptide array peptide array predetermined predetermined participant predetermined Postigo A., Cross JR., Downward J., Way M. Virus - Publications including interactions involving viral proteins suggested by panni Cell Death Differ. (1350-9047) 2006 rapid curation rapid curation Interaction of F1L with the BH3 domain of Bak is responsible for inhibiting vaccinia-induced apoptosis. Interaction of F1L with the BH3 domain of Bak is responsible for inhibiting vaccinia-induced apoptosis. Cell Death Differ. (1350-9047) 2006 rapid curation Postigo A., Cross JR., Downward J., Way M. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown competition binding competition binding predetermined predetermined participant predetermined Postigo A., Cross JR., Downward J., Way M. Virus - Publications including interactions involving viral proteins suggested by panni Cell Death Differ. (1350-9047) 2006 rapid curation rapid curation Interaction of F1L with the BH3 domain of Bak is responsible for inhibiting vaccinia-induced apoptosis. Interaction of F1L with the BH3 domain of Bak is responsible for inhibiting vaccinia-induced apoptosis. Cell Death Differ. (1350-9047) 2006 rapid curation Postigo A., Cross JR., Downward J., Way M. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown pull down pull down predetermined predetermined participant predetermined Postigo A., Cross JR., Downward J., Way M. Virus - Publications including interactions involving viral proteins suggested by panni Cell Death Differ. (1350-9047) 2006 rapid curation rapid curation Interaction of F1L with the BH3 domain of Bak is responsible for inhibiting vaccinia-induced apoptosis. Interaction of F1L with the BH3 domain of Bak is responsible for inhibiting vaccinia-induced apoptosis. Cell Death Differ. (1350-9047) 2006 rapid curation Postigo A., Cross JR., Downward J., Way M. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Postigo A., Cross JR., Downward J., Way M. Virus - Publications including interactions involving viral proteins suggested by panni Cell Death Differ. (1350-9047) 2006 rapid curation rapid curation bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS DIP protein Q16611 original sequence version: 74 DIP protein Q16611 original sequence version: 162 DIP protein Q16611 original sequence version: 97 DIP protein Q16611 original sequence version: 158 DIP protein Q16611 original sequence version: 151 DIP protein Q16611-1 original sequence version: 178 DIP protein Q16611-1 original sequence version: 180 DIP protein Q16611 original sequence version: 121 A2200FE72A46D04E f1_vaccw Protein F1 F1L VACWR040 protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MLSMFMCNNIVDYVDDIDNGIVQDIEDEASNNVDHDYVYPLPENMVYRFDKSTNILDYLSTERDHVMMAVRYYMSKQRLDDLYRQLPTKTRSYIDIINIYCDKVSNDYNRDMNIMYDMASTKSFTVYDINNEVNTILMDNKGLGVRLATISFITELGRRCMNPVETIKMFTLLSHTICDDYFVDYITDISPPDNTIPNTSTREYLKLIGITAIMFATYKTLKYMIG mint 68DC7EB188D29ECA bak1-f1 4 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association F4 homomint mint f1-bak1-1 4 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association F4 homomint mint f1-bak1-2 5 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association F4 homomint mint f1-bak1-3 2 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association F5 homomint mint bak1-f1-1 2 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association F5 homomint mint bak1-f1-2 3 8 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association F6d, F7 homomint mint bak1-bax 5 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association F6d homomint mint bax-bak1-3 5 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association F6d homomint mint bak1-bak1 1 7 unspecified role unspecified role self self 7 unspecified role unspecified role self self physical association physical association F7 homomint mint