MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A novel ubiquitin-binding protein ZNF216 functioning in muscle atrophy. A novel ubiquitin-binding protein ZNF216 functioning in muscle atrophy. EMBO J. (0261-4189) 2006 imex curation Hishiya A., Iemura S., Natsume T., Takayama S., Ikeda K., Watanabe K. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Hishiya A., Iemura S., Natsume T., Takayama S., Ikeda K., Watanabe K. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation A novel ubiquitin-binding protein ZNF216 functioning in muscle atrophy. A novel ubiquitin-binding protein ZNF216 functioning in muscle atrophy. EMBO J. (0261-4189) 2006 imex curation Hishiya A., Iemura S., Natsume T., Takayama S., Ikeda K., Watanabe K. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Hishiya A., Iemura S., Natsume T., Takayama S., Ikeda K., Watanabe K. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation ubc_human Polyubiquitin-C UBC protein protein human Homo sapiens Human MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV B6E7BC06FEE77196 zfan5_human AN1-type zinc finger protein 5 ZNF216 ZFAND5 ZA20D2 Zinc finger protein 216 Zinc finger A20 domain-containing protein 2 protein protein human Homo sapiens Human MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRADTSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI mint E477504B1BA77753 rd23b_human UV excision repair protein RAD23 homolog B XP-C repair-complementing complex 58 kDa protein RAD23B protein protein human Homo sapiens Human MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPTSTPASITPASATASSEPAPASAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED C026C78273BCB289 psmd6_human 26S proteasome non-ATPase regulatory subunit 6 PSMD6 KIAA0107 PFAAP4 26S proteasome regulatory subunit S10 p42A Proteasome regulatory particle subunit p44S10 Phosphonoformate immuno-associated protein 4 Breast cancer-associated protein SGA-113M 26S proteasome regulatory subunit RPN7 protein protein human Homo sapiens Human MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM 8843E6684AE91ACD zfand5-ubc 2 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1958914: original sequence: 1-36 : MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYK flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O76080:p.Cys30Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Tue Jul 12 10:56:09 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:51:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys30ala' Tue Jun 30 17:45:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys30Ala' range MINT-1958918: original sequence: 30-30 : FYGNPRTNGMCSVCYKEHLQ O76080:p.Cys33Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Tue Jul 12 10:55:12 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:30:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys33ala' Tue Jun 30 18:15:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys33Ala' range MINT-1958921: original sequence: 33-33 : NPRTNGMCSVCYKEHLQRQQ Stoichiometry: 1.0 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1B EMBO-Journal ZNF216 directly binds to polyubiquitin. homomint mint zfand5-ubc-1 2 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1C EMBO-Journal ZNF216 directly binds to polyubiquitin homomint mint zfand5-psmd6 2 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell O76080:p.Cys33Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Tue Jul 12 10:58:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:24:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys33ala' Tue Jun 30 19:52:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys33Ala' range MINT-1959049: original sequence: 33-33 : NPRTNGMCSVCYKEHLQRQQ flag tagged flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O76080:p.Cys30Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Tue Jul 12 10:58:20 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:19:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys30ala' Wed May 02 18:05:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys30ala' Tue Jun 30 17:20:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys30Ala' range MINT-1959052: original sequence: 30-30 : FYGNPRTNGMCSVCYKEHLQ O76080:p.Cys170Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Tue Jul 12 10:58:20 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:25:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys170ala' Tue Jun 30 18:52:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys170Ala' range MINT-2789432: original sequence: 170-170 : KVGLTGFDCRCGNLFCGLHR O76080:p.Cys175Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Tue Jul 12 10:58:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:39:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys175ala' Tue Jun 30 17:03:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys175Ala' range MINT-2789435: original sequence: 175-175 : GFDCRCGNLFCGLHRYSDKH Stoichiometry: 1.0 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F2A EMBO-Journal To identify the region of ZNF216 required for association with the 26S proteasome, lysates of cells expressing either FLAGtagged ZNF216 or its mutants were immunoprecipitated with anti-FLAG antibody. Co-precipitation of proteasomal components was monitored by immunoblotting using an antibody against Rpn7p (S10a), homomint mint zfand5-ubc-2 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O76080:p.Cys30Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Tue Jul 12 10:57:09 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:29:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys30ala' Tue Jun 30 17:02:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys30Ala' range MINT-1959029: original sequence: 30-30 : FYGNPRTNGMCSVCYKEHLQ O76080:p.Cys33Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Tue Jul 12 10:57:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:15:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys33ala' Tue Jun 30 20:12:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys33Ala' range MINT-1959032: original sequence: 33-33 : NPRTNGMCSVCYKEHLQRQQ Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction F1E EMBO-Journal As shown in Figure 1E, GST-ZNF216 but not GST bound to polyubiquitin chains homomint mint rad23b-psmd6 1 6 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1977992: original sequence: 185-231 : VTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIP Stoichiometry: 1.0 physical association physical association F2B F7D EMBO-Journal As shown in Figure 2B, GST-Ubl but not GST was pulled down with the endogenous 26S proteasome. homomint mint rad23b-zfand5 1 4 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1978001: original sequence: 185-231 : VTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIP gst tagged gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F2B F7D EMBO-Journal Endogenous ZNF216 was also detected in the GST-Ubl/26S proteasome complex (upper panels, Figure 2B). homomint mint