HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Complex formation between hepatitis C virus NS2 and NS3 proteins. Complex formation between hepatitis C virus NS2 and NS3 proteins. Virus Res. (0168-1702) 2006 imex curation Kiiver K., Merits A., Ustav M., Zusinaite E. Virus - Publications including interactions involving viral proteins Eva Zusinaite@hotmail.com 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kiiver K., Merits A., Ustav M., Zusinaite E. Virus - Publications including interactions involving viral proteins Eva Zusinaite@hotmail.com Accepted 2013-NOV-22 by ORCHARD Virus Res. (0168-1702) 2006 imex curation Complex formation between hepatitis C virus NS2 and NS3 proteins. Complex formation between hepatitis C virus NS2 and NS3 proteins. Virus Res. (0168-1702) 2006 imex curation Kiiver K., Merits A., Ustav M., Zusinaite E. Virus - Publications including interactions involving viral proteins Eva Zusinaite@hotmail.com 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 confocal microscopy confocal microscopy immunostaining immunostaining Kiiver K., Merits A., Ustav M., Zusinaite E. Virus - Publications including interactions involving viral proteins Eva Zusinaite@hotmail.com Accepted 2013-NOV-22 by ORCHARD Virus Res. (0168-1702) 2006 imex curation Complex formation between hepatitis C virus NS2 and NS3 proteins. Complex formation between hepatitis C virus NS2 and NS3 proteins. Virus Res. (0168-1702) 2006 imex curation Kiiver K., Merits A., Ustav M., Zusinaite E. Virus - Publications including interactions involving viral proteins Eva Zusinaite@hotmail.com 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma confocal microscopy confocal microscopy immunostaining immunostaining Kiiver K., Merits A., Ustav M., Zusinaite E. Virus - Publications including interactions involving viral proteins Eva Zusinaite@hotmail.com Accepted 2013-NOV-22 by ORCHARD Virus Res. (0168-1702) 2006 imex curation Complex formation between hepatitis C virus NS2 and NS3 proteins. Complex formation between hepatitis C virus NS2 and NS3 proteins. Virus Res. (0168-1702) 2006 imex curation Kiiver K., Merits A., Ustav M., Zusinaite E. Virus - Publications including interactions involving viral proteins Eva Zusinaite@hotmail.com 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kiiver K., Merits A., Ustav M., Zusinaite E. Virus - Publications including interactions involving viral proteins Eva Zusinaite@hotmail.com Accepted 2013-NOV-22 by ORCHARD Virus Res. (0168-1702) 2006 imex curation Complex formation between hepatitis C virus NS2 and NS3 proteins. Complex formation between hepatitis C virus NS2 and NS3 proteins. Virus Res. (0168-1702) 2006 imex curation Kiiver K., Merits A., Ustav M., Zusinaite E. Virus - Publications including interactions involving viral proteins Eva Zusinaite@hotmail.com 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kiiver K., Merits A., Ustav M., Zusinaite E. Virus - Publications including interactions involving viral proteins Eva Zusinaite@hotmail.com Accepted 2013-NOV-22 by ORCHARD Virus Res. (0168-1702) 2006 imex curation p27958-pro_0000037572 Protease NS2 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) LDTEVAASCGGVVLVGLMALTLSPYYKRYISWCMWWLQYFLTRVEAQLHVWVPPLNVRGGRDAVILLTCVVHPALVFDITKLLLAIFGPLWILQASLLKVPYFVRVQGLLRICALARKIAGGHYVQMAIIKLGALTGTCVYNHLAPLRDWAHNGLRDLAVAVEPVVFSRMETKLITWGADTAACGDIINGLPVSARRGQEILLGPADGMVSKGWRLL 810 1026 2036555B07778591 p27958-pro_0000037573 Serine protease/helicase NS3 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQTYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPTGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAKGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADAGCSGGAYDIIICDECHSTDATSISGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTSGDVVVVSTDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELTPAETTVRLRAYMNTPGLPVCQDHLGFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMRKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEVVT 1027 1657 5601AD5882D04C8F p27958-pro_0000037574 Non-structural protein 4A protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) STWVLVGGVLAALAAYCLSTGCVVIVGRIVLSGKPAIIPDREVLYQEFDEMEEC 1658 1711 527EC748BC450589 ns3-ns4a-10 2 NS3 7 unspecified role unspecified role neutral component neutral component NS4A 8 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 3B ns2-ns3-7 2 NS3 7 unspecified role unspecified role neutral component neutral component NS2 6 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 3A ns2-ns3-2 3 NS3 7 unspecified role unspecified role neutral component neutral component NS2 6 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 4 ns3-ns4a-11 5 NS3 7 unspecified role unspecified role bait bait ie2 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NS4A 8 unspecified role unspecified role prey prey 3f12 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5B and 5C ns3-ns2-1 5 NS3 7 unspecified role unspecified role bait bait ie2 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NS2 6 unspecified role unspecified role prey prey 3f12 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6 ns3-ns2-3 1 NS3 7 unspecified role unspecified role prey prey NS2 6 unspecified role unspecified role bait bait 3f12 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 7B ns3-ns2-4 4 NS3 7 unspecified role unspecified role bait bait NS2 6 unspecified role unspecified role prey prey 3f12 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 7C