MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The cell cycle regulator p27Kip1 interacts with MCM7, a DNA replication licensing factor, to inhibit initiation of DNA replication. The cell cycle regulator p27Kip1 interacts with MCM7, a DNA replication licensing factor, to inhibit initiation of DNA replication. FEBS Lett. (0014-5793) 2005 imex curation Nallamshetty S., Crook M., Boehm M., Yoshimoto T., Olive M., Nabel EG. Virus - Publications including interactions involving viral proteins no status 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast two hybrid array two hybrid array nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Nallamshetty S., Crook M., Boehm M., Yoshimoto T., Olive M., Nabel EG. Virus - Publications including interactions involving viral proteins no status FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation The cell cycle regulator p27Kip1 interacts with MCM7, a DNA replication licensing factor, to inhibit initiation of DNA replication. The cell cycle regulator p27Kip1 interacts with MCM7, a DNA replication licensing factor, to inhibit initiation of DNA replication. FEBS Lett. (0014-5793) 2005 imex curation Nallamshetty S., Crook M., Boehm M., Yoshimoto T., Olive M., Nabel EG. Virus - Publications including interactions involving viral proteins no status 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2h fragment pooling two hybrid fragment pooling approach 2h fragment pooling predetermined predetermined participant predetermined Nallamshetty S., Crook M., Boehm M., Yoshimoto T., Olive M., Nabel EG. Virus - Publications including interactions involving viral proteins no status FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation The cell cycle regulator p27Kip1 interacts with MCM7, a DNA replication licensing factor, to inhibit initiation of DNA replication. The cell cycle regulator p27Kip1 interacts with MCM7, a DNA replication licensing factor, to inhibit initiation of DNA replication. FEBS Lett. (0014-5793) 2005 imex curation Nallamshetty S., Crook M., Boehm M., Yoshimoto T., Olive M., Nabel EG. Virus - Publications including interactions involving viral proteins no status 2009-01-08 Only protein-protein interactions mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Nallamshetty S., Crook M., Boehm M., Yoshimoto T., Olive M., Nabel EG. Virus - Publications including interactions involving viral proteins no status FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation The cell cycle regulator p27Kip1 interacts with MCM7, a DNA replication licensing factor, to inhibit initiation of DNA replication. The cell cycle regulator p27Kip1 interacts with MCM7, a DNA replication licensing factor, to inhibit initiation of DNA replication. FEBS Lett. (0014-5793) 2005 imex curation Nallamshetty S., Crook M., Boehm M., Yoshimoto T., Olive M., Nabel EG. Virus - Publications including interactions involving viral proteins no status 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Nallamshetty S., Crook M., Boehm M., Yoshimoto T., Olive M., Nabel EG. Virus - Publications including interactions involving viral proteins no status FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation cdn1c_human Cyclin-dependent kinase inhibitor 1C Cyclin-dependent kinase inhibitor p57 p57Kip2 CDKN1C KIP2 protein protein human Homo sapiens Human MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSAAPGVGSVEQTPRKRLR A94CCBF09F8CB3E4 cdn1b_mouse Cyclin-dependent kinase inhibitor 1B Cyclin-dependent kinase inhibitor p27 p27Kip1 Cdkn1b protein protein mouse Mus musculus Mouse MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGRYEWQEVERGSLPEFYYRPPRPPKSACKVLAQESQDVSGSRQAVPLIGSQANSEDRHLVDQMPDSSDNPAGLAEQCPGMRKRPAAEDSSSQNKRANRTEENVSDGSPNAGTVEQTPKKPGLRRQT DIP protein P46414 original sequence version: 87 BAC30D648B9BA3D6 cdn1b_human Cyclin-dependent kinase inhibitor 1B Cyclin-dependent kinase inhibitor p27 p27Kip1 CDKN1B KIP1 protein protein human Homo sapiens Human MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT DIP protein P46527 original sequence version: 120 DIP protein P46527 original sequence version: 115 DIP protein P46527 original sequence version: 154 DIP protein P46527 original sequence version: 168 DIP protein P46527 original sequence version: 164 DIP protein P46527 original sequence version: 118 1118D58901CDF3FC mcm7_human DNA replication licensing factor MCM7 MCM7 CDC47 MCM2 CDC47 homolog P1.1-MCM3 protein protein human Homo sapiens Human MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVRSPQNQYPAELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEAHRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPSQFEPLDMKLMRRYIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATYTSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV DIP protein P33993 original sequence version: 161 DIP protein P33993 original sequence version: 124 330A1DEFAEFBFB88 cdn1a_human Cyclin-dependent kinase inhibitor 1 CDKN1A CAP20 CDKN1 CIP1 MDA6 PIC1 SDI1 WAF1 p21 CDK-interacting protein 1 Melanoma differentiation-associated protein 6 protein protein human Homo sapiens Human MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP DIP protein P38936 original sequence version: 120 DIP protein P38936 original sequence version: 165 DIP protein P38936 original sequence version: 160 98D1E7C519ADFCA9 mcm7_mouse DNA replication licensing factor MCM7 CDC47 homolog Mcm7 Cdc47 Mcmd7 protein protein mouse Mus musculus Mouse MALKDYAIEKEKVKKFLQEFYYENELGKKQFKYGTQLVHLAHREQVALYVDLDDIAEDDPELVDSICENAKRYSRLFGDVVQELLPEYKEKEVVNKDVLDVYIEHRLMMEQRSRDPGAVRNPQNQYPSELMRRFELYFRGPSSSKPRVIREVRADSVGKLLTVRGIVTRVSEVKPRMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSKFVKFQEMKIQEHSDQVPVGNIPRSITVVLEGENTRIAQPGDHVSVTGIFLPVLRTGFQQMAQGLLSETYLEAHWIVKMTKSDDDVSGAGELSSEELKQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPQGMKIRGNIHICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNVQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPAQFEPLDMKLMRRYIAMCHERQPTVPESLADYITAAYVEMRREARASKDATYTSARTLLAILRLSTALARLRMVDIVEKEDVNEAIRLMEMSKDSLLGEKGQTARTQRPADVIFATIRELVSRGRSVHFSEAEQRCISRGFTPAQFQAALDEYEELNVWQVNTSRTRITFV DIP protein Q61881 original sequence version: 65 019AE8E04BB8EB3C cdkn1b-mcm7 2 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tagged molecule tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal range MINT-1779958: original sequence: 144-198 : LAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQ Stoichiometry: 1.0 8 full dna sequence full identification by DNA sequencing full dna sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Stoichiometry: 1.0 physical association physical association F1 FEBS-Letters homomint mint cdkn1c-mcm7 1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tagged molecule tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tagged molecule tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Stoichiometry: 1.0 physical association physical association F1 FEBS-Letters homomint mint cdkn1b-mcm7-1 4 MCM7 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Stoichiometry: 1.0 p27Kip1 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F2 F3 FEBS-Letters homomint domino mint cdkn1c-mcm7-1 4 p57Kip2 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 MCM7 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 direct interaction direct interaction F2 FEBS-Letters homomint mint cdkn1a-mcm7 4 MCM7 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 p21 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F2 FEBS-Letters homomint mint mcm7-cdkn1b 3 MCM7 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 6 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F4B FEBS-Letters mint cdkn1b-mcm7-2 3 10 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F4C FEBS-Letters mint