HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Human VAP-B is involved in hepatitis C virus replication through interaction with NS5A and NS5B. Human VAP-B is involved in hepatitis C virus replication through interaction with NS5A and NS5B. J. Virol. (0022-538X) 2005 imex curation Hamamoto I., Nishimura Y., Okamoto T., Aizaki H., Liu M., Mori Y., Abe T., Suzuki T., Lai M.M., Miyamura T., Moriishi K., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken.osaka-u.ac.jp 22-Nov-2013: Contacted by IntAct-Help. Human fetal brain cDNA Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hamamoto I., Nishimura Y., Okamoto T., Aizaki H., Liu M., Mori Y., Abe T., Suzuki T., Lai M.M., Miyamura T., Moriishi K., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken.osaka-u.ac.jp Accepted 2013-NOV-14 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. Human fetal brain cDNA J. Virol. (0022-538X) 2005 imex curation Human VAP-B is involved in hepatitis C virus replication through interaction with NS5A and NS5B. Human VAP-B is involved in hepatitis C virus replication through interaction with NS5A and NS5B. J. Virol. (0022-538X) 2005 imex curation Hamamoto I., Nishimura Y., Okamoto T., Aizaki H., Liu M., Mori Y., Abe T., Suzuki T., Lai M.M., Miyamura T., Moriishi K., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken.osaka-u.ac.jp 22-Nov-2013: Contacted by IntAct-Help. Human fetal brain cDNA Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Hamamoto I., Nishimura Y., Okamoto T., Aizaki H., Liu M., Mori Y., Abe T., Suzuki T., Lai M.M., Miyamura T., Moriishi K., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken.osaka-u.ac.jp Accepted 2013-NOV-14 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. Human fetal brain cDNA J. Virol. (0022-538X) 2005 imex curation Human VAP-B is involved in hepatitis C virus replication through interaction with NS5A and NS5B. Human VAP-B is involved in hepatitis C virus replication through interaction with NS5A and NS5B. J. Virol. (0022-538X) 2005 imex curation Hamamoto I., Nishimura Y., Okamoto T., Aizaki H., Liu M., Mori Y., Abe T., Suzuki T., Lai M.M., Miyamura T., Moriishi K., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken.osaka-u.ac.jp 22-Nov-2013: Contacted by IntAct-Help. Human fetal brain cDNA Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hamamoto I., Nishimura Y., Okamoto T., Aizaki H., Liu M., Mori Y., Abe T., Suzuki T., Lai M.M., Miyamura T., Moriishi K., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken.osaka-u.ac.jp Accepted 2013-NOV-14 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. Human fetal brain cDNA J. Virol. (0022-538X) 2005 imex curation vapa_human Vesicle-associated membrane protein-associated protein A VAPA VAP33 33 kDa VAMP-associated protein protein protein human Homo sapiens Human MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL DIP protein Q9P0L0 original sequence version: 136 DIP protein Q9P0L0 original sequence version: 130 68B603F3A9FA5475 p27958-pro_0000037576 Non-structural protein 5A protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) SGSWLRDIWDWICEVLSDFKTWLKAKLMPQLPGIPFVSCQRGYRGVWRGDGIMHTRCHCGAEITGHVKNGTMRIVGPRTCKNMWSGTFFINAYTTGPCTPLPAPNYKFALWRVSAEEYVEIRRVGDFHYVSGMTTDNLKCPCQIPSPEFFTELDGVRLHRFAPPCKPLLREEVSFRVGLHEYPVGSQLPCEPEPDVAVLTSMLTDPSHITAEAAGRRLARGSPPSMASSSASQLSAPSLKATCTANHDSPDAELIEANLLWRQEMGGNITRVESENKVVILDSFDPLVAEEDEREVSVPAEILRKSRRFAPALPVWARPDYNPLLVETWKKPDYEPPVVHGCPLPPPRSPPVPPPRKKRTVVLTESTLPTALAELATKSFGSSSTSGITGDNTTTSSEPAPSGCPPDSDVESYSSMPPLEGEPGDPDLSDGSWSTVSSGADTEDVVCC 1973 2420 106ED331CF52DACA q03463-pro_0000278740 Non-structural protein 5A protein protein hcvj1 Hepatitis C virus genotype 1b (isolate HC-J1) (HCV) SGSWLRDIWDWICEVLSDFKTWLKTKLMPHLPGIPFVSCQHGYKGVWRGDGIMHTRCHCGAEITGHVKNGTMRIVGPKTCRNMWSGTFPINAYTTGPCTPLPAPNYTFALWRVSAEEYVEIRRVGDFHYVTGMTTDNLKCPCQVPSPEFFTELDGVRLHRFAPPCKPLLREEVSFRVGLHDYPVGSQLPCEPEPDVAVLTSMLTDPSHITAAAAGRRLARGSPPSEASSSASQLSAPSLKATCTINHDSPDAELIEANLLWRQEMGGNITRVESENKVVILDSFDPLVAEEDEREISVPAEILRKSRRFTQALPIWARPDYNPPLIETWKKPNYEPPVVHGCPLPPPQSPPVPPPRKKRTVVLTESTLSTALAELAAKSFGSSSTSGITGDNTTTSSEPAPSGCSPDSDAESYSSMPPLEGEPGDPDLSDGSWSTVSSEAGTEDVVCC 1973 2420 587F253C2E2AE2BC vapb_human Vesicle-associated membrane protein-associated protein B/C VAPB UNQ484/PRO983 protein protein human Homo sapiens Human MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL DIP protein O95292 original sequence version: 141 22AEEF9EC7FC0B3F p27958-pro_0000037577 RNA-directed RNA polymerase protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) SMSYSWTGALVTPCAAEEQKLPINALSNSLLRHHNLVYSTTSRSACQRKKKVTFDRLQVLDSHYQDVLKEVKAAASKVKANLLSVEEACSLAPPHSAKSKFGYGAKDVRCHARKAVAHINSVWKDLLEDSVTPIDTTIMAKNEVFCVQPEKGGRKPARLIVFPDLGVRVCEKMALYDVVSKLPLAVMGSSYGFQYSPGQRVEFLVQAWKSKKTPMGLSYDTRCFDSTVTESDIRTEEAIYQCCDLDPQARVAIKSLTERLYVGGPLTNSRGENCGYRRCRASRVLTTSCGNTLTRYIKARAACRAAGLQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPPQPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIMFAPTLWARMILMTHFFSVLIARDQLEQALNCEIYGACYSIEPLDLPPIIQRLHGLSAFSLHSYSPGEINRVAACLRKLGVPPLRAWRHRAWSVRARLLARGGKAAICGKYLFNWAVRTKLKLTPITAAGRLDLSGWFTAGYSGGDIYHSVSHARPRWFWFCLLLLAAGVGIYLLPNR 2421 3011 2F89B19E29A81A02 q03463-pro_0000278741 RNA-directed RNA polymerase protein protein hcvj1 Hepatitis C virus genotype 1b (isolate HC-J1) (HCV) SMSYTWTGALITPCAAEEQKLPINALSNSLLRHHNLVYSTTSRSACQRQKKVTFDRLQVLDSHYQDVLKEVKAAASKVKANLLSVEEACSLTPPHSAKSKFGYGAKDVRCHARKAVNHINSVWKDLLEDSVTPIQTTIMAKNEVFCVQPEKGGRKPARLIVFPDLGVRVCEKMALYDVVSKLPPAVMGSSYGFQYSPGQRVEFLVQAWKSKRTPMGFSYDTRCFDSTVTESDIRTEEAIYQCCDLDPQARVAIRSLTERLYVGGPLTNSRGENCGYRRCRASGVLTTSCGNTLTCYIKARAACRAAGLQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPPQPEYDLELITSCSSNVSVAHDGTGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIMFAPTLWARMILMTHFFSVLIARDQLEQALDCEIYGACYSIEPLDLPPIIQRLHGLSAFSLHSYSPGEINRVAACLRKLGVPPLRAWRHRARSVRARLLSRGGRAAICGKYLFNWAVRTKLKLTPIAAAGRLDLSGWFTAGYSGGDIYHSVSHARPRWFWFCLLLLAAGVGIYLLPNR 2421 3011 2F495F839553C067 ns5a-vapa-2 3 NS5A 6 unspecified role unspecified role bait bait VAPA 4 unspecified role unspecified role prey prey physical association physical association Fig. 1 ns5a-vapb-3 3 NS5A 6 unspecified role unspecified role bait bait VAPB 7 unspecified role unspecified role prey prey physical association physical association Fig. 1 vapb-ns5a-1 1 NS5A 6 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range VAPB 7 unspecified role unspecified role bait bait n-terminal ee tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2A ns5a-vapa-3 1 VAPA 4 unspecified role unspecified role bait bait n-terminal ee tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NS5A 6 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2A vapb-ns5b-1 1 NS5B 9 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range VAPB 7 unspecified role unspecified role bait bait n-terminal ee tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2B vapa-ns5b-4 1 NS5B 9 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range VAPA 4 unspecified role unspecified role bait bait n-terminal ee tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2B ns5a-vapa-4 2 NS5A 6 unspecified role unspecified role neutral component neutral component n-terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range VAPA 4 unspecified role unspecified role neutral component neutral component n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 3A ns5a-vapb-4 2 NS5A 6 unspecified role unspecified role neutral component neutral component n-terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined VAPB 7 unspecified role unspecified role neutral component neutral component n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Fig. 3A vapa-vapb-1 1 VAPB 7 unspecified role unspecified role bait bait c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range VAPA 4 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 4B vapb-vapb-1 1 VAPB 7 unspecified role unspecified role bait bait c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range VAPB 7 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4A vapb-ns5a-2 1 NS5A 6 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined VAPB 7 unspecified role unspecified role bait bait c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 4C vapb-ns5a-3 1 NS5A 6 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined VAPB 7 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ee tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4D vapb-ns5a-4 1 VAPB 7 unspecified role unspecified role bait bait ee tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NS5A 6 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region 2 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain Q03463-PRO_0000278740:p.His340_Leu344delinsAlaAlaAlaAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain HGCPL AAAAA Wed May 02 15:19:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his_gly_cys_pro_leu340-344ala_ala_ala_ala_ala' Tue Jun 30 19:13:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His340_Leu344delinsAlaAlaAlaAlaAla' physical association physical association Fig. 5 vapb-ns5a-5 1 VAPB 7 unspecified role unspecified role bait bait n-terminal ee tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NS5A 5 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2A vapa-ns5a-1 1 NS5A 5 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range VAPA 4 unspecified role unspecified role bait bait n-terminal ee tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2A vapb-ns5b-2 1 VAPB 7 unspecified role unspecified role bait bait n-terminal ee tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range NS5B 8 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2B vapa-ns5b-3 1 NS5B 8 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range VAPA 4 unspecified role unspecified role bait bait n-terminal ee tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2B