HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Marek's disease virus Meq transforms chicken cells via the v-Jun transcriptional cascade: a converging transforming pathway for avian oncoviruses. Marek's disease virus Meq transforms chicken cells via the v-Jun transcriptional cascade: a converging transforming pathway for avian oncoviruses. Proceedings of the National Academy of Sciences of the United States of America 2005 imex curation Levy AM., Gilad O., Xia L., Izumiya Y., Choi J., Tsalenko A., Yakhini Z., Witter R., Lee L., Cardona CJ., Kung HJ. Virus - Publications including interactions involving viral proteins hkung@ucdavis.edu Only protein-protein interactions imex curation chick-df-1 df-1_chick embryonic fibroblasts Chicken df-1 Primary chicken embryonic fibroblasts DF-1 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Levy AM., Gilad O., Xia L., Izumiya Y., Choi J., Tsalenko A., Yakhini Z., Witter R., Lee L., Cardona CJ., Kung HJ. Virus - Publications including interactions involving viral proteins The Meq protein used is from the GA strain of the Marek's disease virus/Gallid herpesvirus 2, as given in References 2 and 3. The Genbank identifier (AAF67210.1) for this protein was found from Ref 2; Lee L. et al-2000;pmid:10823954. (in entry GenBank: AF147806.2 -Gallid herpesvirus 2, complete genome, GA strain) It has 99.1% homology with the only reviewed UniProt entry for the Meq protein -Q9DGW5. hkung@ucdavis.edu Accepted 2015-JUN-25 by MGT Proceedings of the National Academy of Sciences of the United States of America 2005 imex curation q77q71_9alph R-LORF7 Meq meq MDV005 MDV076 protein protein Gallid herpesvirus 2 Gallid herpesvirus 2 MSQEPEPGAMPYSPADDPSPLDLSLGSTSRRKKRKSHDIPNSPSKHPFPDGLSEEEKQKLERRRKRNRDAARRRRRKQTDYVDKLHEACEELQRANEHLRKEIRDLRTECTSLRVQLACHEPVCPMAVPLTVTLGLLTTPHDPVPEPPICTPPPPSPDEPNAPHCSGSQPPICTPPPPDTEELCAQLCSTPPPPISTPHIIYAPGPSPLQPPICTPPPPDAEELCAQLCSTPPPPICTPHSLFCPPQPPSPEGIFPALCPVTEPCTPPSPGTVYAQLCPVGQAPLFTPSPPHPAPEPERLYARLTEDPEQDSLYSGQIYIQFPSDTQSTVWWFPGDGRP DF16E8F68C88463A jun_chick Transcription factor AP-1 Proto-oncogene c-Jun JUN protein protein chick Gallus gallus (Chicken) Chicken MSAKMEPTFYEDALNASFAPPESGGYGYNNAKVLKQSMTLNLSDAASSLKPHLRNKNADILTSPDVGLLKLASPELERLIIQSSNGLITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHNQNTLPSVTSAAQPVSGGMAPVSSMAGGGSFNTSLHSEPPVYANLSNFNPNALNSAPNYNANGMGYAPQHHINPQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF B882DBFACEDDE1B1 meq-cjun-1 1 2 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association 4C