MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Raver2, a new member of the hnRNP family. Raver2, a new member of the hnRNP family. FEBS Lett. (0014-5793) 2005 imex curation Kleinhenz B., Fabienke M., Swiniarski S., Wittenmayer N., Kirsch J., Jockusch BM., Arnold HH., Illenberger S. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Kleinhenz B., Fabienke M., Swiniarski S., Wittenmayer N., Kirsch J., Jockusch BM., Arnold HH., Illenberger S. Virus - Publications including interactions involving viral proteins no FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation Raver2, a new member of the hnRNP family. Raver2, a new member of the hnRNP family. FEBS Lett. (0014-5793) 2005 imex curation Kleinhenz B., Fabienke M., Swiniarski S., Wittenmayer N., Kirsch J., Jockusch BM., Arnold HH., Illenberger S. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast two hybrid array two hybrid array nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kleinhenz B., Fabienke M., Swiniarski S., Wittenmayer N., Kirsch J., Jockusch BM., Arnold HH., Illenberger S. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation Raver2, a new member of the hnRNP family. Raver2, a new member of the hnRNP family. FEBS Lett. (0014-5793) 2005 imex curation Kleinhenz B., Fabienke M., Swiniarski S., Wittenmayer N., Kirsch J., Jockusch BM., Arnold HH., Illenberger S. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kleinhenz B., Fabienke M., Swiniarski S., Wittenmayer N., Kirsch J., Jockusch BM., Arnold HH., Illenberger S. Virus - Publications including interactions involving viral proteins no FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation Raver2, a new member of the hnRNP family. Raver2, a new member of the hnRNP family. FEBS Lett. (0014-5793) 2005 imex curation Kleinhenz B., Fabienke M., Swiniarski S., Wittenmayer N., Kirsch J., Jockusch BM., Arnold HH., Illenberger S. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions in vivo in vivo anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Kleinhenz B., Fabienke M., Swiniarski S., Wittenmayer N., Kirsch J., Jockusch BM., Arnold HH., Illenberger S. Virus - Publications including interactions involving viral proteins no FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation Raver2, a new member of the hnRNP family. Raver2, a new member of the hnRNP family. FEBS Lett. (0014-5793) 2005 imex curation Kleinhenz B., Fabienke M., Swiniarski S., Wittenmayer N., Kirsch J., Jockusch BM., Arnold HH., Illenberger S. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kleinhenz B., Fabienke M., Swiniarski S., Wittenmayer N., Kirsch J., Jockusch BM., Arnold HH., Illenberger S. Virus - Publications including interactions involving viral proteins no FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation Raver2, a new member of the hnRNP family. Raver2, a new member of the hnRNP family. FEBS Lett. (0014-5793) 2005 imex curation Kleinhenz B., Fabienke M., Swiniarski S., Wittenmayer N., Kirsch J., Jockusch BM., Arnold HH., Illenberger S. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast two hybrid pooling two hybrid pooling approach two hybrid pooling nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kleinhenz B., Fabienke M., Swiniarski S., Wittenmayer N., Kirsch J., Jockusch BM., Arnold HH., Illenberger S. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation q8r509_mouse Ptbp1 mPTB1 protein protein mouse Mus musculus Mouse MDGIVPDIAVGTKRGSDELFSTCVSNGPFIMSSSASAANGNDSKKFKGDNRSAGVPSRVIHVRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAASTMVNYYTSVAPVLRGQPNYIQFSNHKELKTDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRVDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGLSVPNVHGALAPLAIPSAAAAAAASRIAIPGLAGAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGSQAQLAMSHLNGHKLHGKSVRITLSKHQSVQLPREGQEDQGLTKDYGSSPLHRFKKPGSKNFQNIFLPSATLHLSNIPPSVSEDDLKSLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIELHNHDLGEHHLRVSFSKSTI mint AF1DB4DDDFD618B8 ravr2_mouse Ribonucleoprotein PTB-binding 2 Raver2 Kiaa1579 Protein raver-2 protein protein mouse Mus musculus Mouse MAARGGGAGGAGSGSGPSAGTAGEAAEPALRPGEVAALHPQEVAARLQRMRRELSNRRKILVKNLPQDSSSQEVHELLQDYELKYCYVDRNKRTAFVTLLNGEQAQSAIQRFHQFSFRGRELTVQLQPTDALLCITNLPISFTLEEFEELVRAYGNIERCFLVYSEVTGHSKGYGFVEYMKKDFAAKARLELLGRQMGASALFAQWMDVNLLASELIHSKCLCIDKLPSDYSDSEELLQLFSGIHKPVFCQLAQDEGSHGGGFAVVEYSTAEHAEEVQQVADGITIKGSQVQLSFCAPGAPGRSTLAVLIAAQRAMHSNQKGLLPEPNPVQIMKSLNNPAMLQVLLQPQLCGRAMKPVLGVAPSLSHLLSPSLPSAILHFSKAQQSSAVGNTSSLILQNLSPLPLIQQQLMKFDNAHTNNKPGLLGEPPAMVLQPALAIGPPLPLKTDLGHHGEAHKTSNLIPPQTTLAAGLGMLPFFSNQLPAGQAGPGRGTTQEKQSASVSISEASFSGSQHYLQTFPGLPAGGPLTGNQKTPQSQPKGTEVASKNQTSLLGEPPKEIRLSKNPYLNLASVLPSVCLSTAGKGMPPKTGIASNILDAISQGSESQHALEKCIAYSPSIEDYAQASSLRNEKRGSSYLISAPEGGPVELAGQHPQDTGVSYTETYLKKKRVY mint May bind single stranded nucleic acids 6E31A65A272CE243 ptbp1_human Polypyrimidine tract-binding protein 1 PTBP1 PTB Heterogeneous nuclear ribonucleoprotein I 57 kDa RNA-binding protein PPTB-1 protein protein human Homo sapiens Human MDGIVPDIAVGTKRGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGLSVPNVHGALAPLAIPSAAAAAAAAGRIAIPGLAGAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPREGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI BE12D5EA21537BED ptbp1-raver2 2 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5A FEBS-Letters mint raver2-ptbp1 5 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F5B FEBS-Letters mint ptbp1-raver2-1 5 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F5B FEBS-Letters mint raver2-ptbp1-1 6 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5A FEBS-Letters mint ptbp1-raver2-2 3 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F5C FEBS-Letters mint raver2-ptbp1-2 3 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction NFA FEBS pag 4257 destra prime 5 righe mint raver2-ptbp1-3 4 7 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F6B SHORTLABEL = mouse C2c12 cells mint ptbp1-raver2-3 1 Raver2 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 PTB 9 monoclonal immunost monoclonal antibody immunostaining monoclonal immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Stoichiometry: 1.0 colocalization colocalization F6A homomint mint