MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Insights into hRPA32 C-terminal domain--mediated assembly of the simian virus 40 replisome. Insights into hRPA32 C-terminal domain--mediated assembly of the simian virus 40 replisome. Nat. Struct. Mol. Biol. (1545-9993) 2005 Arunkumar AI., Klimovich V., Jiang X., Ott RD., Mizoue L., Fanning E., Chazin WJ. Virus - Publications including interactions involving viral proteins no in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Arunkumar AI., Klimovich V., Jiang X., Ott RD., Mizoue L., Fanning E., Chazin WJ. Virus - Publications including interactions involving viral proteins no Nat. Struct. Mol. Biol. (1545-9993) 2005 Insights into hRPA32 C-terminal domain--mediated assembly of the simian virus 40 replisome. Insights into hRPA32 C-terminal domain--mediated assembly of the simian virus 40 replisome. Nat. Struct. Mol. Biol. (1545-9993) 2005 Arunkumar AI., Klimovich V., Jiang X., Ott RD., Mizoue L., Fanning E., Chazin WJ. Virus - Publications including interactions involving viral proteins no in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Arunkumar AI., Klimovich V., Jiang X., Ott RD., Mizoue L., Fanning E., Chazin WJ. Virus - Publications including interactions involving viral proteins no Nat. Struct. Mol. Biol. (1545-9993) 2005 lt_sv40 Large T antigen protein protein sv40 sv40 SV40 MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNEENLFCSEEMPSSDDEATADSQHSTPPKKKRKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESLPGGLKEHDFNPEEAEETKQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFEMCLKCIKKEQPSHYKYHEKHYANAAIFADSKNQKTICQQAVDTVLAKKRVDSLQLTREQMLTNRFNDLLDRMDIMFGSTGSADIEEWMAGVAWLHCLLPKMDSVVYDFLKCMVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGGESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEYSVPKTLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWKERLDKEFSLSVYQKMKFNVAMGIGVLDWLRNSDDDDEDSQENADKNEDGGEKNMEDSGHETGIDSQSQGSFQAPQSSQSVHDHNQPYHICRGFTCFKKPPTPPPEPET 3E37D4BAFC5D59BD rfa2_human Replication protein A 32 kDa subunit RPA34 Replication protein A 34 kDa subunit Replication factor A protein 2 RPA2 REPA2 RPA32 protein protein human Homo sapiens Human MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE DIP protein P15927 original sequence version: 119 DIP protein P15927-1 original sequence version: 125 DIP protein P15927 original sequence version: 114 61A563EA7B34A9B1 lt-rpa2 2 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region nmr nuclear magnetic resonance NMR nmr NMR certain certain sequence position certain certain certain sequence position certain range MINT-1343620: original sequence: 252-268 : EGHIYSTVDDDHFKST undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:09:29 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing ' range MINT-1343622: original sequence: 252-252 : IKQAVDFLSNEGHIYSTVDD range MINT-1343623: original sequence: 268-268 : TVDDDHFKSTDA Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region nmr nuclear magnetic resonance NMR nmr NMR certain certain sequence position certain certain certain sequence position certain range MINT-1343630: original sequence: 154-259 : RTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESLPGGLKEHDFN undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:09:35 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing ' range MINT-1343632: original sequence: 154-154 : SFLSHAVFSNRTLACFAIYT Stoichiometry: 1.0 direct interaction direct interaction 500 versus 60 micromolar F2FG F3ABC homomint mint rpa2-lt 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1343650: original sequence: 137-258 : DFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESLPGGLKEHDF Stoichiometry: 1.0 direct interaction direct interaction F2A homomint mint