MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Protein-protein interaction between monomers of coliphage HK022 excisionase. Protein-protein interaction between monomers of coliphage HK022 excisionase. FEBS Lett. (0014-5793) 2004 imex curation Gottfried P., Kolot M., Silberstein N., Yagil E. Virus - Publications including interactions involving viral proteins no Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink predetermined predetermined participant predetermined Gottfried P., Kolot M., Silberstein N., Yagil E. Virus - Publications including interactions involving viral proteins no FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation Protein-protein interaction between monomers of coliphage HK022 excisionase. Protein-protein interaction between monomers of coliphage HK022 excisionase. FEBS Lett. (0014-5793) 2004 imex curation Gottfried P., Kolot M., Silberstein N., Yagil E. Virus - Publications including interactions involving viral proteins no Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Gottfried P., Kolot M., Silberstein N., Yagil E. Virus - Publications including interactions involving viral proteins no FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation Protein-protein interaction between monomers of coliphage HK022 excisionase. Protein-protein interaction between monomers of coliphage HK022 excisionase. FEBS Lett. (0014-5793) 2004 imex curation Gottfried P., Kolot M., Silberstein N., Yagil E. Virus - Publications including interactions involving viral proteins no Only protein-protein interactions in vitro In vitro bifunctional agent crosslink protein cross-linking with a bifunctional reagent Label transfer techniques Photoaffinity labelling Label transfer techniques Photoaffinity labelling bifunctional agent crosslink western blot western blot Immuno blot Immuno blot Gottfried P., Kolot M., Silberstein N., Yagil E. Virus - Publications including interactions involving viral proteins no FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation Protein-protein interaction between monomers of coliphage HK022 excisionase. Protein-protein interaction between monomers of coliphage HK022 excisionase. FEBS Lett. (0014-5793) 2004 imex curation Gottfried P., Kolot M., Silberstein N., Yagil E. Virus - Publications including interactions involving viral proteins no Only protein-protein interactions in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gottfried P., Kolot M., Silberstein N., Yagil E. Virus - Publications including interactions involving viral proteins no FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation vxis_bp434 Excisionase xis protein protein bp434 Bacteriophage 434 MYLTLQEWNARQRRPRSLETVRRWVRECRIFPPPVKDGREYLFHESAVKVDLNRPVTGSLLKRIRNGKKAKS mint Excisionase and integrase are necessary for the excision of prophage from the host genome by site-specific recombination at the att site 0E6A4843503344AA xis-xis 4 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5 FEBS-Letters mint xis-xis-1 2 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F1 Crosslink agent is disuccinimidyl suberate FEBS-Letters mint xis-xis-2 3 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F2A Experiment is performed in presence of DTT as crosslinking agent FEBS-Letters mint xis-xis-3 1 xis 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 xis 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F3A Experiment is performed in presence of DSS (disuccimidyl suberate) as crosslinking agent FEBS-Letters mint xis-xis-4 1 xis 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 xis 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component living cell living cell his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3B Experiment is performed in presence of DSS (disuccimidyl suberate) as crosslinking agent FEBS-Letters mint xis-xis-5 1 xis 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined xis 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3C Experiment is performed in presence of DSS (disuccimidyl suberate) as crosslinking agent FEBS-Letters mint