MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Role of the PDZ domain-binding motif of the oncoprotein E6 in the pathogenesis of human papillomavirus type 31. Role of the PDZ domain-binding motif of the oncoprotein E6 in the pathogenesis of human papillomavirus type 31. J. Virol. (0022-538X) 2004 rapid curation Lee C., Laimins LA. Virus - Publications including interactions involving viral proteins manually identified rapid curation unknown Unknown fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Lee C., Laimins LA. Virus - Publications including interactions involving viral proteins manually identified manually identified J. Virol. (0022-538X) 2004 rapid curation rapid curation Role of the PDZ domain-binding motif of the oncoprotein E6 in the pathogenesis of human papillomavirus type 31. Role of the PDZ domain-binding motif of the oncoprotein E6 in the pathogenesis of human papillomavirus type 31. J. Virol. (0022-538X) 2004 rapid curation Lee C., Laimins LA. Virus - Publications including interactions involving viral proteins manually identified rapid curation unknown Unknown pull down pull down predetermined predetermined participant predetermined Lee C., Laimins LA. Virus - Publications including interactions involving viral proteins manually identified manually identified J. Virol. (0022-538X) 2004 rapid curation rapid curation ve6_hpv03 Protein E6 E6 protein protein hpv03 Human papillomavirus type 3 MAVAMSMDANCPKNIFLLCRNTGIGFDDLRLHCIFCTKQLTTTELQAFALRELNVVWRRGAPYGACARCLLVEGIARRLKYWEYSYYVSGVEEETKQSIDTQQIRCYMCHKPLVKEEKDRHRNEKRRLHKISGHWRGSCQYCWSRCTVRIPR mint Transcriptional transactivator. Binds double stranded DNA 50E869412755862F dlg1_human Disks large homolog 1 DLG1 Synapse-associated protein 97 hDlg protein protein human Homo sapiens Human MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSSTVTSETLPSSLSPSVEKYRYQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTEAVLPSPPTVPVIPVLPVPAENTVILPTIPQANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWVPAKEKL DIP protein Q12959 original sequence version: 178 6722993A84D0F761 e6-dlg1 2 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association F1 homomint mint dlg1-e6-3 1 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component physical association physical association F1 homomint mint