HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Hepatitis C virus NS5A protein interacts with 2',5'-oligoadenylate synthetase and inhibits antiviral activity of IFN in an IFN sensitivity-determining region-independent manner. Hepatitis C virus NS5A protein interacts with 2',5'-oligoadenylate synthetase and inhibits antiviral activity of IFN in an IFN sensitivity-determining region-independent manner. J. Gen. Virol. (0022-1317) 2004 imex curation Taguchi T., Nagano-Fujii M., Akutsu M., Kadoya H., Ohgimoto S., Ishido S., Hotta H. Virus - Publications including interactions involving viral proteins In PMID:10211956, HCV-1bjk is assigned the Genebank ID AB010249 however no Uniprot ID could be found. Reference HCV isolate H is used instead. hotta@kobe-u.ac.jp 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Taguchi T., Nagano-Fujii M., Akutsu M., Kadoya H., Ohgimoto S., Ishido S., Hotta H. Virus - Publications including interactions involving viral proteins In PMID:10211956, HCV-1bjk is assigned the Genebank ID AB010249 however no Uniprot ID could be found. Reference HCV isolate H is used instead. hotta@kobe-u.ac.jp Accepted 2015-FEB-09 by PPORRAS J. Gen. Virol. (0022-1317) 2004 Only protein-protein interactions imex curation Hepatitis C virus NS5A protein interacts with 2',5'-oligoadenylate synthetase and inhibits antiviral activity of IFN in an IFN sensitivity-determining region-independent manner. Hepatitis C virus NS5A protein interacts with 2',5'-oligoadenylate synthetase and inhibits antiviral activity of IFN in an IFN sensitivity-determining region-independent manner. J. Gen. Virol. (0022-1317) 2004 imex curation Taguchi T., Nagano-Fujii M., Akutsu M., Kadoya H., Ohgimoto S., Ishido S., Hotta H. Virus - Publications including interactions involving viral proteins In PMID:10211956, HCV-1bjk is assigned the Genebank ID AB010249 however no Uniprot ID could be found. Reference HCV isolate H is used instead. hotta@kobe-u.ac.jp 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Taguchi T., Nagano-Fujii M., Akutsu M., Kadoya H., Ohgimoto S., Ishido S., Hotta H. Virus - Publications including interactions involving viral proteins In PMID:10211956, HCV-1bjk is assigned the Genebank ID AB010249 however no Uniprot ID could be found. Reference HCV isolate H is used instead. hotta@kobe-u.ac.jp Accepted 2015-FEB-09 by PPORRAS J. Gen. Virol. (0022-1317) 2004 Only protein-protein interactions imex curation Hepatitis C virus NS5A protein interacts with 2',5'-oligoadenylate synthetase and inhibits antiviral activity of IFN in an IFN sensitivity-determining region-independent manner. Hepatitis C virus NS5A protein interacts with 2',5'-oligoadenylate synthetase and inhibits antiviral activity of IFN in an IFN sensitivity-determining region-independent manner. J. Gen. Virol. (0022-1317) 2004 imex curation Taguchi T., Nagano-Fujii M., Akutsu M., Kadoya H., Ohgimoto S., Ishido S., Hotta H. Virus - Publications including interactions involving viral proteins In PMID:10211956, HCV-1bjk is assigned the Genebank ID AB010249 however no Uniprot ID could be found. Reference HCV isolate H is used instead. hotta@kobe-u.ac.jp 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pull down pull down western blot western blot Immuno blot Immuno blot Taguchi T., Nagano-Fujii M., Akutsu M., Kadoya H., Ohgimoto S., Ishido S., Hotta H. Virus - Publications including interactions involving viral proteins In PMID:10211956, HCV-1bjk is assigned the Genebank ID AB010249 however no Uniprot ID could be found. Reference HCV isolate H is used instead. hotta@kobe-u.ac.jp Accepted 2015-FEB-09 by PPORRAS J. Gen. Virol. (0022-1317) 2004 Only protein-protein interactions imex curation Hepatitis C virus NS5A protein interacts with 2',5'-oligoadenylate synthetase and inhibits antiviral activity of IFN in an IFN sensitivity-determining region-independent manner. Hepatitis C virus NS5A protein interacts with 2',5'-oligoadenylate synthetase and inhibits antiviral activity of IFN in an IFN sensitivity-determining region-independent manner. J. Gen. Virol. (0022-1317) 2004 imex curation Taguchi T., Nagano-Fujii M., Akutsu M., Kadoya H., Ohgimoto S., Ishido S., Hotta H. Virus - Publications including interactions involving viral proteins In PMID:10211956, HCV-1bjk is assigned the Genebank ID AB010249 however no Uniprot ID could be found. Reference HCV isolate H is used instead. hotta@kobe-u.ac.jp 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma pull down pull down anti tag western anti tag western blot anti tag western Taguchi T., Nagano-Fujii M., Akutsu M., Kadoya H., Ohgimoto S., Ishido S., Hotta H. Virus - Publications including interactions involving viral proteins In PMID:10211956, HCV-1bjk is assigned the Genebank ID AB010249 however no Uniprot ID could be found. Reference HCV isolate H is used instead. hotta@kobe-u.ac.jp Accepted 2015-FEB-09 by PPORRAS J. Gen. Virol. (0022-1317) 2004 Only protein-protein interactions imex curation oas1_human 2'-5'-oligoadenylate synthase 1 OAS1 OIAS E18/E16 p46/p42 OAS protein protein human Homo sapiens Human MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL 03F0A3AA17DAD4E4 oas1a_mouse 2'-5'-oligoadenylate synthase 1A Oas1a Oias1 p42 OAS protein protein mouse Mus musculus Mouse MEHGLRSIPAWTLDKFIEDYLLPDTTFGADVKSAVNVVCDFLKERCFQGAAHPVRVSKVVKGGSSGKGTTLKGKSDADLVVFLNNLTSFEDQLNRRGEFIKEIKKQLYEVQHERRFRVKFEVQSSWWPNARSLSFKLSAPHLHQEVEFDVLPAFDVLGHVNTSSKPDPRIYAILIEECTSLGKDGEFSTCFTELQRNFLKQRPTKLKSLIRLVKHWYQLCKEKLGKPLPPQYALELLTVFAWEQGNGCYEFNTAQGFRTVLELVINYQHLRIYWTKYYDFQHQEVSKYLHRQLRKARPVILDPADPTGNVAGGNPEGWRRLAEEADVWLWYPCFIKKDGSRVSSWDVPTVVPVPFEQVEENWTCILL AE5946D5807776A4 o89168_9hepc protein protein 9hepc Hepatitis C virus SGSWLKDVWDWICTVLTDFKTWLQSKLLPKLPGVPFFSCQRGYKGVWRGDGIMQTTCPCGAQITGHVKNGSMRIVGPKTCSNTWHGTFPINAYTTGPCTPSPAPNYSRALWRVAAEEYVEITRVGDFHYVTGMTTDNVKCPCQVPAPEFFTELDGVRLHRYAPACRPLLRVDVTFQVGLNQYLVGSQLPCEPEPDVAVLTSMLTDPSHITAETAKRRPARGSPPSLASSSASQLSAPSLKATCTTHHDSPDADLIEANLLWRQEMGGNITRVESENKVVILDSFDPLRAEEDEREVSVAAEILRKSKNFPPALPIWARPDYNPPLLESWKSPDYVPPAVHGCPLPPTTGPPIPPPRKKRTVVLTESTVSSALAELATKTFGSSGSSAVDSGTATAPPDQTSDDGDKESDIESYSSMPPLEGEPGDPDLSDGSWSTVSGEAGDDVVCC 1AC0ED49CB35004B ns5a-25as 2 6 unspecified role unspecified role unspecified role unspecified role ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role unspecified role unspecified role flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization 2A ns5a-25as-1 3 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait n-terminal region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2B oas1a-ns5a 4 6 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2B oas1a-ns5a-1 4 7 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range O89168:p.Phe37Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain F N Wed May 02 17:01:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe37asn' Tue Jun 30 16:29:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe37Asn' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O89168:p.Phe37Leu mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain F L Thu Jul 07 12:15:58 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was phe37leu Wed May 02 19:01:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe37leu' Tue Jun 30 17:15:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe37Leu' 6 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 3A, 3C and 4 ns5a-25as-2 1 7 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3B ns5a-25as-3 4 5 unspecified role unspecified role bait bait n-terminal region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role prey prey O89168:p.Phe37Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain F N Thu Jul 07 12:16:46 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was phe37asn Wed May 02 20:03:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe37asn' Tue Jun 30 20:03:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe37Asn' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 6A