MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Vaccinia virus A36R membrane protein provides a direct link between intracellular enveloped virions and the microtubule motor kinesin. Vaccinia virus A36R membrane protein provides a direct link between intracellular enveloped virions and the microtubule motor kinesin. J. Virol. (0022-538X) 2004 rapid curation Ward BM., Moss B. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown competition binding competition binding predetermined predetermined participant predetermined Ward BM., Moss B. Virus - Publications including interactions involving viral proteins suggested by panni J. Virol. (0022-538X) 2004 rapid curation rapid curation Vaccinia virus A36R membrane protein provides a direct link between intracellular enveloped virions and the microtubule motor kinesin. Vaccinia virus A36R membrane protein provides a direct link between intracellular enveloped virions and the microtubule motor kinesin. J. Virol. (0022-538X) 2004 rapid curation Ward BM., Moss B. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ward BM., Moss B. Virus - Publications including interactions involving viral proteins suggested by panni J. Virol. (0022-538X) 2004 rapid curation rapid curation Vaccinia virus A36R membrane protein provides a direct link between intracellular enveloped virions and the microtubule motor kinesin. Vaccinia virus A36R membrane protein provides a direct link between intracellular enveloped virions and the microtubule motor kinesin. J. Virol. (0022-538X) 2004 rapid curation Ward BM., Moss B. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown pull down pull down predetermined predetermined participant predetermined Ward BM., Moss B. Virus - Publications including interactions involving viral proteins suggested by panni J. Virol. (0022-538X) 2004 rapid curation rapid curation Vaccinia virus A36R membrane protein provides a direct link between intracellular enveloped virions and the microtubule motor kinesin. Vaccinia virus A36R membrane protein provides a direct link between intracellular enveloped virions and the microtubule motor kinesin. J. Virol. (0022-538X) 2004 rapid curation Ward BM., Moss B. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown protein three hybrid protein three hybrid trihybrid bridge assay protein 3-hybrid protein tri hybrid trihybrid bridge assay predetermined predetermined participant predetermined Ward BM., Moss B. Virus - Publications including interactions involving viral proteins suggested by panni J. Virol. (0022-538X) 2004 rapid curation rapid curation a33_vaccw Protein A33 VACWR156 A33R protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MMTPENDEEQTSVFSATVYGDKIQGKNKRKRVIGLCIRISMVISLLSMITMSAFLIVRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN mint 201CF65C2D2076A4 a36_vaccw Protein A36 VACWR159 A36R protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MMLVPLITVTVVAGTILVCYILYICRKKIRTVYNDNKIIMTKLKKIKSSNSSKSSKSTDSESDWEDHCSAMEQNNDVDNISRNEILDDDSFAGSLIWDNESNVMAPSTEHIYDSVAGSTLLINNDRNEQTIYQNTTVVINETETVEVLNEDTKQNPNYSSNPFVNYNKTSICSKSNPFITELNNKFSENNPFRRAHSDDYLNKQEQDHEHDDIESSVVSLV mint homomint 5D15758981B0E2E2 klc1_rat Kinesin light chain 1 Klc1 Klc Kns2 protein protein rat Rattus norvegicus (Rat) Rat MHDNMSTMVYMKEEKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDSDSSKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDGSSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAALRSRKQGLDNVHKQRVAEVLNDPENVEKRRSRESLNVDVVKYESGPDGGEEVSMSVEWNGMRKMKLGLVK DIP protein P37285 original sequence version: 83 24D0C4CF9E304366 a36-klc1 2 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association F1 mint a36-klc1-1 3 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association F2 mint a36-klc1-2 3 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association F3 mint a36-klc1-3 4 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association F5 mint a33-a36 4 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component physical association physical association F5 homomint mint a33-a36-1 1 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component physical association physical association T2 homomint mint