HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Characterization of the chromosomal binding sites and dimerization partners of the viral oncoprotein Meq in Marek's disease virus-transformed T cells. Characterization of the chromosomal binding sites and dimerization partners of the viral oncoprotein Meq in Marek's disease virus-transformed T cells. Journal of virology 2003 imex curation Levy AM., Izumiya Y., Brunovskis P., Xia L., Parcells MS., Reddy SM., Lee L., Chen HW., Kung HJ. Virus - Publications including interactions involving viral proteins interaction between Meq and CREB, ATF1, 2 and 3 is not captured since the host species is not specified virus strain not specified and the reference uniprot id Q9DGW5 is used instaed hkung@ucdavis.edu 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation chick-msb-1 chick lymphoblastoid cell line Chicken msb-1 chicken lymphoblastoid cell line MSB-1 confocal microscopy confocal microscopy immunostaining immunostaining Levy AM., Izumiya Y., Brunovskis P., Xia L., Parcells MS., Reddy SM., Lee L., Chen HW., Kung HJ. Virus - Publications including interactions involving viral proteins interaction between Meq and CREB, ATF1, 2 and 3 is not captured since the host species is not specified hkung@ucdavis.edu hkung @ucdavis.edu Accepted 2016-MAR-08 AT 09:37 GMT AT 09:37 GMT by ORCHARD Journal of virology 2003 imex curation I'm not sure if i should capture fig 1c data and how? - yes you can, as these are in vitro expts with purified proteins. Create the probes as new>interactor>nucleic acid, then as SSDNA. Import them as participants, add radiolabel and this is your bait, protein are prey. Characterization of the chromosomal binding sites and dimerization partners of the viral oncoprotein Meq in Marek's disease virus-transformed T cells. Characterization of the chromosomal binding sites and dimerization partners of the viral oncoprotein Meq in Marek's disease virus-transformed T cells. Journal of virology 2003 imex curation Levy AM., Izumiya Y., Brunovskis P., Xia L., Parcells MS., Reddy SM., Lee L., Chen HW., Kung HJ. Virus - Publications including interactions involving viral proteins interaction between Meq and CREB, ATF1, 2 and 3 is not captured since the host species is not specified virus strain not specified and the reference uniprot id Q9DGW5 is used instaed hkung@ucdavis.edu 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation chick-msb-1 chick lymphoblastoid cell line Chicken msb-1 chicken lymphoblastoid cell line MSB-1 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Levy AM., Izumiya Y., Brunovskis P., Xia L., Parcells MS., Reddy SM., Lee L., Chen HW., Kung HJ. Virus - Publications including interactions involving viral proteins interaction between Meq and CREB, ATF1, 2 and 3 is not captured since the host species is not specified hkung@ucdavis.edu hkung @ucdavis.edu Accepted 2016-MAR-08 AT 09:37 GMT AT 09:37 GMT by ORCHARD Journal of virology 2003 imex curation I'm not sure if i should capture fig 1c data and how? - yes you can, as these are in vitro expts with purified proteins. Create the probes as new>interactor>nucleic acid, then as SSDNA. Import them as participants, add radiolabel and this is your bait, protein are prey. Characterization of the chromosomal binding sites and dimerization partners of the viral oncoprotein Meq in Marek's disease virus-transformed T cells. Characterization of the chromosomal binding sites and dimerization partners of the viral oncoprotein Meq in Marek's disease virus-transformed T cells. Journal of virology 2003 imex curation Levy AM., Izumiya Y., Brunovskis P., Xia L., Parcells MS., Reddy SM., Lee L., Chen HW., Kung HJ. Virus - Publications including interactions involving viral proteins interaction between Meq and CREB, ATF1, 2 and 3 is not captured since the host species is not specified virus strain not specified and the reference uniprot id Q9DGW5 is used instaed hkung@ucdavis.edu 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Levy AM., Izumiya Y., Brunovskis P., Xia L., Parcells MS., Reddy SM., Lee L., Chen HW., Kung HJ. Virus - Publications including interactions involving viral proteins interaction between Meq and CREB, ATF1, 2 and 3 is not captured since the host species is not specified hkung@ucdavis.edu hkung @ucdavis.edu Accepted 2016-MAR-08 AT 09:37 GMT AT 09:37 GMT by ORCHARD Journal of virology 2003 imex curation I'm not sure if i should capture fig 1c data and how? - yes you can, as these are in vitro expts with purified proteins. Create the probes as new>interactor>nucleic acid, then as SSDNA. Import them as participants, add radiolabel and this is your bait, protein are prey. Characterization of the chromosomal binding sites and dimerization partners of the viral oncoprotein Meq in Marek's disease virus-transformed T cells. Characterization of the chromosomal binding sites and dimerization partners of the viral oncoprotein Meq in Marek's disease virus-transformed T cells. Journal of virology 2003 imex curation Levy AM., Izumiya Y., Brunovskis P., Xia L., Parcells MS., Reddy SM., Lee L., Chen HW., Kung HJ. Virus - Publications including interactions involving viral proteins interaction between Meq and CREB, ATF1, 2 and 3 is not captured since the host species is not specified virus strain not specified and the reference uniprot id Q9DGW5 is used instaed hkung@ucdavis.edu 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Levy AM., Izumiya Y., Brunovskis P., Xia L., Parcells MS., Reddy SM., Lee L., Chen HW., Kung HJ. Virus - Publications including interactions involving viral proteins interaction between Meq and CREB, ATF1, 2 and 3 is not captured since the host species is not specified hkung@ucdavis.edu hkung @ucdavis.edu Accepted 2016-MAR-08 AT 09:37 GMT AT 09:37 GMT by ORCHARD Journal of virology 2003 imex curation I'm not sure if i should capture fig 1c data and how? - yes you can, as these are in vitro expts with purified proteins. Create the probes as new>interactor>nucleic acid, then as SSDNA. Import them as participants, add radiolabel and this is your bait, protein are prey. Characterization of the chromosomal binding sites and dimerization partners of the viral oncoprotein Meq in Marek's disease virus-transformed T cells. Characterization of the chromosomal binding sites and dimerization partners of the viral oncoprotein Meq in Marek's disease virus-transformed T cells. Journal of virology 2003 imex curation Levy AM., Izumiya Y., Brunovskis P., Xia L., Parcells MS., Reddy SM., Lee L., Chen HW., Kung HJ. Virus - Publications including interactions involving viral proteins interaction between Meq and CREB, ATF1, 2 and 3 is not captured since the host species is not specified virus strain not specified and the reference uniprot id Q9DGW5 is used instaed hkung@ucdavis.edu 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Levy AM., Izumiya Y., Brunovskis P., Xia L., Parcells MS., Reddy SM., Lee L., Chen HW., Kung HJ. Virus - Publications including interactions involving viral proteins interaction between Meq and CREB, ATF1, 2 and 3 is not captured since the host species is not specified hkung@ucdavis.edu hkung @ucdavis.edu Accepted 2016-MAR-08 AT 09:37 GMT AT 09:37 GMT by ORCHARD Journal of virology 2003 imex curation I'm not sure if i should capture fig 1c data and how? - yes you can, as these are in vitro expts with purified proteins. Create the probes as new>interactor>nucleic acid, then as SSDNA. Import them as participants, add radiolabel and this is your bait, protein are prey. fos_rat Proto-oncogene c-Fos Fos Cellular oncogene fos protein protein rat Rattus norvegicus (Rat) Rat MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANFIPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTPSTGAYARAGVVKTMSGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPNDLGFPEEMSVTSLDLTGGLPEATTPESEEAFTLPLLNDPEPKPSLEPVKNISNMELKAEPFDDFLFPASSRPSGSETARSVPDVDLSGSFYAADWEPLHSSSLGMGPMVTELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL mint Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation E62D16A88CB2BEE9 junb_mouse Transcription factor jun-B Junb Jun-b MyD21 protein protein mouse Mus musculus Mouse MCTKMEQPFYHDDSYAAAGYGRSPGSLSLHDYKLLKPTLALNLADPYRGLKGPGARGPGPEGSGAGSYFSGQGSDTGASLKLASTELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGTGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGASGGPQAGPGGVYAGPEPPPVYTNLSSYSPASAPSGGSGTAVGTGSSYPTATISYLPHAPPFAGGHPAQLGLSRGASAFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSAAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF 6F52D4FECC32E234 cre cyclic AMP response element ss dna single stranded deoxyribonucleic acid ss DNA ss dna rat Rattus norvegicus (Rat) Rat TGACGTCA mdv-ori ss dna single stranded deoxyribonucleic acid ss DNA ss dna Gallid herpesvirus 2 Gallid herpesvirus 2 ACACA jun_rat Transcription factor AP-1 Jun Rjg-9 Activator protein 1 V-jun avian sarcoma virus 17 oncogene homolog Proto-oncogene c-Jun protein protein rat Rattus norvegicus (Rat) Rat MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGALSSGGGAPSYGATGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF mint Transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3' AFD9DF7D7C791B58 tre c-Jun promoter probe ss dna single stranded deoxyribonucleic acid ss DNA ss dna chick Gallus gallus (Chicken) Chicken TGACATCA jun_chick Transcription factor AP-1 Proto-oncogene c-Jun JUN protein protein chick Gallus gallus (Chicken) Chicken MSAKMEPTFYEDALNASFAPPESGGYGYNNAKVLKQSMTLNLSDAASSLKPHLRNKNADILTSPDVGLLKLASPELERLIIQSSNGLITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHNQNTLPSVTSAAQPVSGGMAPVSSMAGGGSFNTSLHSEPPVYANLSNFNPNALNSAPNYNANGMGYAPQHHINPQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF B882DBFACEDDE1B1 meq_gahvm Oncoprotein MEQ MDV005 MDV076 protein protein gahvm Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) GaHV-2 Marek's disease herpesvirus type 1 MSQEPEPGAMPYSPADDPSPLDLSLGSTSRRKKRKSHDIPNSPSKHPFPDGLSEEEKQKLERRRKRNRDAARRRRRKQTDYVDKLHEACEELQRANEHLRKEIRDLRTECTSLRVQLACHEPVCPMAVPLTVTLGLLTTPHDPVPEPPICTPPPPSPDEPNAPHCSGSQPPICTPPPPDTEELCAQLCSTPPPPISTPHIIYAPGPSPLQPPICTPAPPDAEELCAQLCSTPPPPICTPHSLFCPPQPPSPEGIFPALCPVTEPCTPPSPGTVYAQLCPVGQVPLFTPSPPHPAPEPERLYARLTEDPEQDSLYSGQIYTQFPSDTQSTVWWFPGDGRP jun-meq-1 5 12 unspecified role unspecified role bait bait 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain t7 tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1A junb-meq-1 5 7 unspecified role unspecified role bait bait 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain t7 tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1A meq-cjun-3 2 12 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association 3A meq-jun-2 1 12 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component colocalization colocalization 3B mdv005-jun-1 3 12 unspecified role unspecified role prey prey 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain t7 tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1A mdv005-junb-1 3 7 unspecified role unspecified role prey prey 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain t7 tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1A meq-meq-2 4 13 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction 1C meq-jun-3 4 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 1C meq-jun-4 4 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role bait bait 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 1C meq-fos-1 4 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role bait bait 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 1C meq-fos-2 4 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction 1C