HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Hepatitis C virus nonstructural protein NS3 binds to Sm-D1, a small nuclear ribonucleoprotein associated with autoimmune disease. Hepatitis C virus nonstructural protein NS3 binds to Sm-D1, a small nuclear ribonucleoprotein associated with autoimmune disease. Microbiol. Immunol. (0385-5600) 2003 imex curation Iwai A., Hasumura Y., Nojima T., Takegami T. Virus - Publications including interactions involving viral proteins PMID : no link - accessed by using first authors (Atsushi IWAI) publication record. Use DOI: 10.1111/j.1348-0421.2003.tb03423.x takegami@kanazawa-med.ac.jp 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Iwai A., Hasumura Y., Nojima T., Takegami T. Virus - Publications including interactions involving viral proteins PMID : no link - accessed by using first authors (Atsushi IWAI) publication record. Use DOI: 10.1111/j.1348-0421.2003.tb03423.x takegami@kanazawa-med.ac.jp Accepted 2014-JUN-30 by MGT Microbiol. Immunol. (0385-5600) 2003 imex curation Hepatitis C virus nonstructural protein NS3 binds to Sm-D1, a small nuclear ribonucleoprotein associated with autoimmune disease. Hepatitis C virus nonstructural protein NS3 binds to Sm-D1, a small nuclear ribonucleoprotein associated with autoimmune disease. Microbiol. Immunol. (0385-5600) 2003 imex curation Iwai A., Hasumura Y., Nojima T., Takegami T. Virus - Publications including interactions involving viral proteins PMID : no link - accessed by using first authors (Atsushi IWAI) publication record. Use DOI: 10.1111/j.1348-0421.2003.tb03423.x takegami@kanazawa-med.ac.jp 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions human-kn73 KN73 Human Hepatoma cell line kn73 KN73 human Hepatoma cell line fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Iwai A., Hasumura Y., Nojima T., Takegami T. Virus - Publications including interactions involving viral proteins PMID : no link - accessed by using first authors (Atsushi IWAI) publication record. Use DOI: 10.1111/j.1348-0421.2003.tb03423.x takegami@kanazawa-med.ac.jp Accepted 2014-JUN-30 by MGT Microbiol. Immunol. (0385-5600) 2003 imex curation Hepatitis C virus nonstructural protein NS3 binds to Sm-D1, a small nuclear ribonucleoprotein associated with autoimmune disease. Hepatitis C virus nonstructural protein NS3 binds to Sm-D1, a small nuclear ribonucleoprotein associated with autoimmune disease. Microbiol. Immunol. (0385-5600) 2003 imex curation Iwai A., Hasumura Y., Nojima T., Takegami T. Virus - Publications including interactions involving viral proteins PMID : no link - accessed by using first authors (Atsushi IWAI) publication record. Use DOI: 10.1111/j.1348-0421.2003.tb03423.x takegami@kanazawa-med.ac.jp 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Iwai A., Hasumura Y., Nojima T., Takegami T. Virus - Publications including interactions involving viral proteins PMID : no link - accessed by using first authors (Atsushi IWAI) publication record. Use DOI: 10.1111/j.1348-0421.2003.tb03423.x takegami@kanazawa-med.ac.jp Accepted 2014-JUN-30 by MGT Microbiol. Immunol. (0385-5600) 2003 imex curation Hepatitis C virus nonstructural protein NS3 binds to Sm-D1, a small nuclear ribonucleoprotein associated with autoimmune disease. Hepatitis C virus nonstructural protein NS3 binds to Sm-D1, a small nuclear ribonucleoprotein associated with autoimmune disease. Microbiol. Immunol. (0385-5600) 2003 imex curation Iwai A., Hasumura Y., Nojima T., Takegami T. Virus - Publications including interactions involving viral proteins PMID : no link - accessed by using first authors (Atsushi IWAI) publication record. Use DOI: 10.1111/j.1348-0421.2003.tb03423.x takegami@kanazawa-med.ac.jp 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Iwai A., Hasumura Y., Nojima T., Takegami T. Virus - Publications including interactions involving viral proteins PMID : no link - accessed by using first authors (Atsushi IWAI) publication record. Use DOI: 10.1111/j.1348-0421.2003.tb03423.x takegami@kanazawa-med.ac.jp Accepted 2014-JUN-30 by MGT Hela Microbiol. Immunol. (0385-5600) 2003 imex curation Hepatitis C virus nonstructural protein NS3 binds to Sm-D1, a small nuclear ribonucleoprotein associated with autoimmune disease. Hepatitis C virus nonstructural protein NS3 binds to Sm-D1, a small nuclear ribonucleoprotein associated with autoimmune disease. Microbiol. Immunol. (0385-5600) 2003 imex curation Iwai A., Hasumura Y., Nojima T., Takegami T. Virus - Publications including interactions involving viral proteins PMID : no link - accessed by using first authors (Atsushi IWAI) publication record. Use DOI: 10.1111/j.1348-0421.2003.tb03423.x takegami@kanazawa-med.ac.jp 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Iwai A., Hasumura Y., Nojima T., Takegami T. Virus - Publications including interactions involving viral proteins PMID : no link - accessed by using first authors (Atsushi IWAI) publication record. Use DOI: 10.1111/j.1348-0421.2003.tb03423.x takegami@kanazawa-med.ac.jp Accepted 2014-JUN-30 by MGT Microbiol. Immunol. (0385-5600) 2003 imex curation smd1_human Small nuclear ribonucleoprotein Sm D1 SNRPD1 snRNP core protein D1 Sm-D autoantigen protein protein human Homo sapiens Human MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR DIP protein P62314 original sequence version: 77 DIP protein P62314 original sequence version: 100 DIP protein P62314 original sequence version: 86 DIP protein P62314 original sequence version: 135 0C81C94BF98E0810 p27958-pro_0000037573 Serine protease/helicase NS3 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQTYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPTGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAKGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADAGCSGGAYDIIICDECHSTDATSISGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTSGDVVVVSTDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELTPAETTVRLRAYMNTPGLPVCQDHLGFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMRKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEVVT 1027 1657 5601AD5882D04C8F p27958_pro-snrpd1 4 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association No figure ns3-smd1 3 7 unspecified role unspecified role prey prey mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait n terminal tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 1B ns3-smd1 5 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey c_terminal_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2 ns3-smd1-1 1 7 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey n terminal tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4B Sm-D1 bound to the amino terminal region of NS3. ns3-smd1-2 2 7 unspecified role unspecified role neutral component neutral component flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 5 ns3-smd1-3 3 7 unspecified role unspecified role prey prey mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait n terminal tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 competitor competitor competitor unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association 3 snrpd1-p27958_pro 3 7 unspecified role unspecified role prey prey mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait n terminal tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 3i