MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Modulation of p120E4F transcriptional activity by the Gam1 adenoviral early protein. Modulation of p120E4F transcriptional activity by the Gam1 adenoviral early protein. Oncogene (0950-9232) 2003 rapid curation Colombo R., Draetta GF., Chiocca S. Virus - Publications including interactions involving viral proteins suggested by asmolyard rapid curation unknown Unknown anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Colombo R., Draetta GF., Chiocca S. Virus - Publications including interactions involving viral proteins suggested by asmolyard Oncogene (0950-9232) 2003 rapid curation rapid curation Modulation of p120E4F transcriptional activity by the Gam1 adenoviral early protein. Modulation of p120E4F transcriptional activity by the Gam1 adenoviral early protein. Oncogene (0950-9232) 2003 rapid curation Colombo R., Draetta GF., Chiocca S. Virus - Publications including interactions involving viral proteins suggested by asmolyard rapid curation unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Colombo R., Draetta GF., Chiocca S. Virus - Publications including interactions involving viral proteins suggested by asmolyard Oncogene (0950-9232) 2003 rapid curation rapid curation Modulation of p120E4F transcriptional activity by the Gam1 adenoviral early protein. Modulation of p120E4F transcriptional activity by the Gam1 adenoviral early protein. Oncogene (0950-9232) 2003 rapid curation Colombo R., Draetta GF., Chiocca S. Virus - Publications including interactions involving viral proteins suggested by asmolyard rapid curation unknown Unknown pull down pull down predetermined predetermined participant predetermined Colombo R., Draetta GF., Chiocca S. Virus - Publications including interactions involving viral proteins suggested by asmolyard Oncogene (0950-9232) 2003 rapid curation rapid curation Modulation of p120E4F transcriptional activity by the Gam1 adenoviral early protein. Modulation of p120E4F transcriptional activity by the Gam1 adenoviral early protein. Oncogene (0950-9232) 2003 rapid curation Colombo R., Draetta GF., Chiocca S. Virus - Publications including interactions involving viral proteins suggested by asmolyard rapid curation unknown Unknown 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Colombo R., Draetta GF., Chiocca S. Virus - Publications including interactions involving viral proteins suggested by asmolyard Oncogene (0950-9232) 2003 rapid curation rapid curation gam1_adeg1 Protein GAM-1 8 Gallus-anti morte protein Gam1 protein protein fadv-1 Fowl adenovirus A serotype 1 (strain CELO / Phelps) MARNPFRMFPGDLPYYMGTISFTSVVPVDPSQRNPTTSLREMVTTGLIFNPNLTGEQLREYSFSPLVSMGRKAIFADYEGPQRIIHVTIRGRSAEPKTPSEALIMMEKAVRGAFAVPDWVAREYSDPLPHGITHVGDLGFPIGSVHALKMALDTLKIHVPRGVGVPGYEGLCGTTTIKAPRQYRLLTTGVFTKKDLKRTLPEPFFSRFFNQTPEVCAIKTGKNPFSTEIWCMTLGGDSPAPERNEPRNPHSLQDWARLGVMETCLRMSRRGLGSRHHPYHSL Early protein essential for viral replication. Strong and global transcriptional activator of both viral and cellular genes. Activates transcription by blocking host retinoblastoma protein (RB) and inhibiting the SUMO pathway. Inhibition of host RB leads to the activation of E2F1-dependent transcription and, in particuliar, of E2F1-regulated S-phase genes. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. Blocks the SUMO pathway by targeting the E1 enzyme (SAE1/UBA2 heterodimer) to the ubiquitin-proteasome machinery. Mediates SAE1 degradation possibly through the formation of complexes with either CUL2-elongin BC complex-RBX1 or CUL5-elongin BC complex-RBX1. The degradation of UBA2 is probably a consequent effect of SAE1 disappearance. Inhibits HDAC1 sumoylation, thereby interfering with histone deacetylation mediated by HDAC1, leading to activation of transcription. Mediates induction of heat-shock response. Seems to have an antiapoptotic function mint 5F817469544C67A3 e4f1_human Transcription factor E4F1 E4F1 E4F Putative E3 ubiquitin-protein ligase E4F1 E4F transcription factor 1 Transcription factor E4F p120E4F p50E4F RING-type E3 ubiquitin transferase E4F1 protein protein human Homo sapiens Human MEGAMAVRVTAAHTAEAQAEAGREAGEGAVAAVAAALAPSGFLGLPAPFSEEDEDDVHRCGRCQAEFTALEDFVQHKIQKACQRAPPEALPATPATTALLGQEVVPAAPGPEEPITVAHIVVEAASLAADISHASDLVGGGHIKEVIVAAEAELGDGEMAEAPGSPRQQGLGLAGEGEQAQVKLLVNKDGRYVCALCHKTFKTGSILKAHMVTHSSRKDHECKLCGASFRTKGSLIRHHRRHTDERPYKCSKCGKSFRESGALTRHLKSLTPCTEKIRFSVSKDVVVSKEDARAGSGAGAAGLGTATSSVTGEPIETSPVIHLVTDAKGTVIHEVHVQMQELSLGMKALAPEPPVSQELPCSSEGSRENLLHQAMQNSGIVLERAAGEEGALEPAPAAGSSPQPLAVAAPQLPVLEVQPLETQVASEASAVPRTHPCPQCSETFPTAATLEAHKRGHTGPRPFACAQCGKAFPKAYLLKKHQEVHVRERRFRCGDCGKLYKTIAHVRGHRRVHSDERPYPCPKCGKRYKTKNAQQVHFRTHLEEKPHVCQFCSRGFREKGSLVRHVRHHTGEKPFKCYKCGRGFAEHGTLNRHLRTKGGCLLEVEELLVSEDSPAAATTVLTEDPHTVLVEFSSVVADTQEYIIEATADDAETSEATEIIEGTQTEVDSHIMKVVQQIVHQASAGHQIIVQNVTMDEETALGPEAAAADTITIATPESLTEQVAMTLASAISEGTVLAARAGTSGTEQATVTMVSSEDIEILEHAGELVIASPEGQLEVQTVIV 60F6E711F2748FD8 hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 gam1-e4f1 4 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association homomint mint e4f1-gam1 2 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association F1 A homomint mint gam1-e4f1-1 3 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association F1B F1 B homomint mint hdac1-e4f1 3 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association F2 a F3 homomint mint hdac1-e4f1-1 1 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association F2 b F4 homomint mint e4f1-hdac1-2 1 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association F2 c F4 homomint mint e4f1-gam1-1 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association F2 c F4 homomint mint gam1-hdac1 1 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association F4 homomint mint