MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Mapping and functional analysis of interaction sites within the cytoplasmic domains of the vaccinia virus A33R and A36R envelope proteins. Mapping and functional analysis of interaction sites within the cytoplasmic domains of the vaccinia virus A33R and A36R envelope proteins. J. Virol. (0022-538X) 2003 rapid curation Ward BM., Weisberg AS., Moss B. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ward BM., Weisberg AS., Moss B. Virus - Publications including interactions involving viral proteins suggested by panni J. Virol. (0022-538X) 2003 rapid curation rapid curation Mapping and functional analysis of interaction sites within the cytoplasmic domains of the vaccinia virus A33R and A36R envelope proteins. Mapping and functional analysis of interaction sites within the cytoplasmic domains of the vaccinia virus A33R and A36R envelope proteins. J. Virol. (0022-538X) 2003 rapid curation Ward BM., Weisberg AS., Moss B. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ward BM., Weisberg AS., Moss B. Virus - Publications including interactions involving viral proteins suggested by panni J. Virol. (0022-538X) 2003 rapid curation rapid curation Mapping and functional analysis of interaction sites within the cytoplasmic domains of the vaccinia virus A33R and A36R envelope proteins. Mapping and functional analysis of interaction sites within the cytoplasmic domains of the vaccinia virus A33R and A36R envelope proteins. J. Virol. (0022-538X) 2003 rapid curation Ward BM., Weisberg AS., Moss B. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Ward BM., Weisberg AS., Moss B. Virus - Publications including interactions involving viral proteins suggested by panni J. Virol. (0022-538X) 2003 rapid curation rapid curation a33_vaccw Protein A33 VACWR156 A33R protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MMTPENDEEQTSVFSATVYGDKIQGKNKRKRVIGLCIRISMVISLLSMITMSAFLIVRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN mint 201CF65C2D2076A4 a36_vaccw Protein A36 VACWR159 A36R protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MMLVPLITVTVVAGTILVCYILYICRKKIRTVYNDNKIIMTKLKKIKSSNSSKSSKSTDSESDWEDHCSAMEQNNDVDNISRNEILDDDSFAGSLIWDNESNVMAPSTEHIYDSVAGSTLLINNDRNEQTIYQNTTVVINETETVEVLNEDTKQNPNYSSNPFVNYNKTSICSKSNPFITELNNKFSENNPFRRAHSDDYLNKQEQDHEHDDIESSVVSLV mint homomint 5D15758981B0E2E2 b5_vaccw Protein B5 PS/HR Plaque-size/host range protein B5R VACWR187 protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIVALTIMGVIFLISVIVLVCSCDKNNDQYKFHKLLP Regulation of plaque size and host range mint 0816C384779E76B1 a33-a36-3 2 5 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component physical association physical association T1 T2 homomint mint a33-a36-4 1 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association F2 homomint mint a33-a36-5 3 5 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization F5 homomint mint a36-ps_hr 3 6 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component colocalization colocalization F5 homomint mint