HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html DC-SIGN and L-SIGN are high affinity binding receptors for hepatitis C virus glycoprotein E2. DC-SIGN and L-SIGN are high affinity binding receptors for hepatitis C virus glycoprotein E2. J. Biol. Chem. (0021-9258) 2003 imex curation Lozach P.Y., Lortat-Jacob H., de Lacroix de Lavalette A., Staropoli I., Foung S., Amara A., Houles C., Fieschi F., Schwartz O., Virelizier J.L., Arenzana-Seisdedos F., Altmeyer R. Virus - Publications including interactions involving viral proteins altmeyer@pasteur.fr 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs tag visualisation tag visualisation Lozach P.Y., Lortat-Jacob H., de Lacroix de Lavalette A., Staropoli I., Foung S., Amara A., Houles C., Fieschi F., Schwartz O., Virelizier J.L., Arenzana-Seisdedos F., Altmeyer R. Virus - Publications including interactions involving viral proteins The lectin ligand mannan and the HIV envelope glycoprotein gp140 efficiently inhibited binding of sE2man and sE2cpx to both lectins (Fig. 4, A and B). altmeyer@pasteur.fr Accepted 2014-MAY-01 by ORCHARD J. Biol. Chem. (0021-9258) 2003 imex curation DC-SIGN and L-SIGN are high affinity binding receptors for hepatitis C virus glycoprotein E2. DC-SIGN and L-SIGN are high affinity binding receptors for hepatitis C virus glycoprotein E2. J. Biol. Chem. (0021-9258) 2003 imex curation Lozach P.Y., Lortat-Jacob H., de Lacroix de Lavalette A., Staropoli I., Foung S., Amara A., Houles C., Fieschi F., Schwartz O., Virelizier J.L., Arenzana-Seisdedos F., Altmeyer R. Virus - Publications including interactions involving viral proteins altmeyer@pasteur.fr 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lozach P.Y., Lortat-Jacob H., de Lacroix de Lavalette A., Staropoli I., Foung S., Amara A., Houles C., Fieschi F., Schwartz O., Virelizier J.L., Arenzana-Seisdedos F., Altmeyer R. Virus - Publications including interactions involving viral proteins altmeyer@pasteur.fr Accepted 2014-MAY-01 by ORCHARD J. Biol. Chem. (0021-9258) 2003 imex curation cd209_human CD209 antigen CD209 CLEC4L C-type lectin domain family 4 member L Dendritic cell-specific ICAM-3-grabbing non-integrin 1 protein protein human Homo sapiens Human MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA DIP protein Q9NNX6 original sequence version: 125 DIP protein Q9NNX6 original sequence version: 127 A23FA246014533C0 q03463-pro_0000278734 Envelope glycoprotein E2 protein protein hcvj1 Hepatitis C virus genotype 1b (isolate HC-J1) (HCV) ETIVSGGQAARAMSGLVSLFTPGAKQNIQLINTNGSWHINSTALNCNESLNTGWLAGLIYQHKFNSSGCPERLASCRRLTDFDQGWGPISHANGSGPDQRPYCWHYPPKPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYNWGANDTDVFVLNNTRPPLGNWFGCTWMNSTGFTKVCGAPPCVIGGGGNNTLHCPTDCFRKHPEATYSRCGSGPWITPRCLVDYPYRLWHYPCTINYTIFKVRMYVGGVEHRLDAACNWTRGERCDLEDRDRSELSPLLLSTTQWQVLPCSFTTLPALSTGLIHLHQNIVDVQYLYGVGSSIASWAIKWEYVVLLFLLLADARVCSCLWMMLLISQAEA 384 746 E2E9EDD7FCE7E03C clc4m_human C-type lectin domain family 4 member M CD209 antigen-like protein 1 Dendritic cell-specific ICAM-3-grabbing non-integrin 2 DC-SIGN-related protein Liver/lymph node-specific ICAM-3-grabbing non-integrin CLEC4M CD209L CD209L1 CD299 protein protein human Homo sapiens Human MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGALVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE 0FADC99F72AEA593 cd209-q03463_pro-2 1 3 unspecified role unspecified role neutral component neutral component human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 4 unspecified role unspecified role neutral component neutral component 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 3B Interaction occur in the presence (sE2man) or absence (sE2cpx) of 1-manosidase I and II inhibitors 1-deoxymannojirimycin hydrochloride (DMJ, 1 mM, Calbiochem) and swainsonine (5 mM, Sigma). HIV protein p140/160, reference proteome P04578-PRO_0000239240) or manna (CHEBI:288080) competed with this interaction. clec4m-q03463_pro-1 1 5 unspecified role unspecified role neutral component neutral component human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 4 unspecified role unspecified role neutral component neutral component 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 3B Interaction occur in the presence (sE2man) or absence (sE2cpx) of 1-manosidase I and II inhibitors 1-deoxymannojirimycin hydrochloride (DMJ, 1 mM, Calbiochem) and swainsonine (5 mM, Sigma). HIV protein p140/160, reference proteome P04578-PRO_0000239240) or manna (CHEBI:288080) competed with this interaction. cd209-q03463_pro-1 2 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mesau-bhk Mesocricetus auratus baby kidney cell line BHK bhk Golden (Syrian) Hamster baby kidney cell line BHK Established from the kidneys of five unsexed, one-day-old hamsters in 1961. 3 unspecified role unspecified role bait bait crd region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 18 20 direct interaction direct interaction Fig. 5