HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html The hepatitis C virus NS2 protein is an inhibitor of CIDE-B-induced apoptosis. The hepatitis C virus NS2 protein is an inhibitor of CIDE-B-induced apoptosis. J. Biol. Chem. (0021-9258) 2003 imex curation Erdtmann L., Franck N., Lerat H., Le Seyec J., Gilot D., Cannie I., Gripon P., Hibner U., Guguen-Guillouzo C. Virus - Publications including interactions involving viral proteins lars. erdtmann@univ-rennes1.fr 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Erdtmann L., Franck N., Lerat H., Le Seyec J., Gilot D., Cannie I., Gripon P., Hibner U., Guguen-Guillouzo C. Virus - Publications including interactions involving viral proteins lars. erdtmann@univ-rennes1.fr Accepted 2013-SEP-23 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Human liver cDNA J. Biol. Chem. (0021-9258) 2003 imex curation The hepatitis C virus NS2 protein is an inhibitor of CIDE-B-induced apoptosis. The hepatitis C virus NS2 protein is an inhibitor of CIDE-B-induced apoptosis. J. Biol. Chem. (0021-9258) 2003 imex curation Erdtmann L., Franck N., Lerat H., Le Seyec J., Gilot D., Cannie I., Gripon P., Hibner U., Guguen-Guillouzo C. Virus - Publications including interactions involving viral proteins lars. erdtmann@univ-rennes1.fr 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Erdtmann L., Franck N., Lerat H., Le Seyec J., Gilot D., Cannie I., Gripon P., Hibner U., Guguen-Guillouzo C. Virus - Publications including interactions involving viral proteins lars. erdtmann@univ-rennes1.fr Accepted 2013-SEP-23 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2003 imex curation The hepatitis C virus NS2 protein is an inhibitor of CIDE-B-induced apoptosis. The hepatitis C virus NS2 protein is an inhibitor of CIDE-B-induced apoptosis. J. Biol. Chem. (0021-9258) 2003 imex curation Erdtmann L., Franck N., Lerat H., Le Seyec J., Gilot D., Cannie I., Gripon P., Hibner U., Guguen-Guillouzo C. Virus - Publications including interactions involving viral proteins lars. erdtmann@univ-rennes1.fr 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Erdtmann L., Franck N., Lerat H., Le Seyec J., Gilot D., Cannie I., Gripon P., Hibner U., Guguen-Guillouzo C. Virus - Publications including interactions involving viral proteins lars. erdtmann@univ-rennes1.fr Accepted 2013-SEP-23 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2003 imex curation The hepatitis C virus NS2 protein is an inhibitor of CIDE-B-induced apoptosis. The hepatitis C virus NS2 protein is an inhibitor of CIDE-B-induced apoptosis. J. Biol. Chem. (0021-9258) 2003 imex curation Erdtmann L., Franck N., Lerat H., Le Seyec J., Gilot D., Cannie I., Gripon P., Hibner U., Guguen-Guillouzo C. Virus - Publications including interactions involving viral proteins lars. erdtmann@univ-rennes1.fr 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Erdtmann L., Franck N., Lerat H., Le Seyec J., Gilot D., Cannie I., Gripon P., Hibner U., Guguen-Guillouzo C. Virus - Publications including interactions involving viral proteins lars. erdtmann@univ-rennes1.fr Accepted 2013-SEP-23 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2003 imex curation The hepatitis C virus NS2 protein is an inhibitor of CIDE-B-induced apoptosis. The hepatitis C virus NS2 protein is an inhibitor of CIDE-B-induced apoptosis. J. Biol. Chem. (0021-9258) 2003 imex curation Erdtmann L., Franck N., Lerat H., Le Seyec J., Gilot D., Cannie I., Gripon P., Hibner U., Guguen-Guillouzo C. Virus - Publications including interactions involving viral proteins lars. erdtmann@univ-rennes1.fr 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Erdtmann L., Franck N., Lerat H., Le Seyec J., Gilot D., Cannie I., Gripon P., Hibner U., Guguen-Guillouzo C. Virus - Publications including interactions involving viral proteins lars. erdtmann@univ-rennes1.fr Accepted 2013-SEP-23 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2003 imex curation cideb_human Cell death activator CIDE-B CIDEB Cell death-inducing DFFA-like effector B protein protein human Homo sapiens Human MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQWQQKGRLHSY E0B4E5EF1F7C912D p27958-pro_0000037572 Protease NS2 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) LDTEVAASCGGVVLVGLMALTLSPYYKRYISWCMWWLQYFLTRVEAQLHVWVPPLNVRGGRDAVILLTCVVHPALVFDITKLLLAIFGPLWILQASLLKVPYFVRVQGLLRICALARKIAGGHYVQMAIIKLGALTGTCVYNHLAPLRDWAHNGLRDLAVAVEPVVFSRMETKLITWGADTAACGDIINGLPVSARRGQEILLGPADGMVSKGWRLL 810 1026 2036555B07778591 ns2-cide-b-1 1 NS2 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain CIDE-B 6 unspecified role unspecified role prey prey human-liver Homo sapiens liver liver liver physical association physical association Fig. 1A cideb-ns2-1 3 CIDE-B 6 unspecified role unspecified role unspecified role unspecified role NS2 7 unspecified role unspecified role unspecified role unspecified role region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 2A cideb-cideb-1 3 CIDE-B 6 unspecified role unspecified role bait bait CIDE-B 6 unspecified role unspecified role prey prey Q9UHD4:p.Tyr160Phe mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 15:43:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr160phe' Tue Jun 30 15:46:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr160Phe' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1B, 3B and 3D cide-b-cide-b-1 5 CIDE-B 6 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro CIDE-B 6 unspecified role unspecified role unspecified role unspecified role gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 2B and 3C p27958_pro-cideb-2 5 NS2 7 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) CIDE-B 6 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 29 33 physical association physical association Fig. 2B and 3C cideb-ns2-3 2 NS2 7 unspecified role unspecified role neutral component neutral component gfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain CIDE-B 6 unspecified role unspecified role neutral component neutral component flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 4A cideb-ns2-4 4 NS2 7 unspecified role unspecified role prey prey gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). CIDE-B 6 electron acceptor electron acceptor bait bait ecoli Escherichia coli (strain K12) physical association physical association Fig. 4B p27958_pro-cideb-1 3 NS2 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain CIDE-B 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UHD4:p.Tyr160Phe mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 14:38:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr160phe' Tue Jun 30 19:29:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr160Phe' 47 49 physical association physical association Fig. 3B, 3D