HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Identification of a lactoferrin-derived peptide possessing binding activity to hepatitis C virus E2 envelope protein. Identification of a lactoferrin-derived peptide possessing binding activity to hepatitis C virus E2 envelope protein. J. Biol. Chem. (0021-9258) 2003 imex curation Nozaki A., Ikeda M., Naganuma A., Nakamura T., Inudoh M., Tanaka K., Kato N. Virus - Publications including interactions involving viral proteins nkato@md.okayama-u.ac.jp Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting anti tag western anti tag western blot anti tag western Nozaki A., Ikeda M., Naganuma A., Nakamura T., Inudoh M., Tanaka K., Kato N. Virus - Publications including interactions involving viral proteins nkato@md.okayama-u.ac.jp Accepted 2015-MAR-19 by PPORRAS J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation Identification of a lactoferrin-derived peptide possessing binding activity to hepatitis C virus E2 envelope protein. Identification of a lactoferrin-derived peptide possessing binding activity to hepatitis C virus E2 envelope protein. J. Biol. Chem. (0021-9258) 2003 imex curation Nozaki A., Ikeda M., Naganuma A., Nakamura T., Inudoh M., Tanaka K., Kato N. Virus - Publications including interactions involving viral proteins nkato@md.okayama-u.ac.jp Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa immunostaining immunostaining Nozaki A., Ikeda M., Naganuma A., Nakamura T., Inudoh M., Tanaka K., Kato N. Virus - Publications including interactions involving viral proteins nkato@md.okayama-u.ac.jp Accepted 2015-MAR-19 by PPORRAS J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation Identification of a lactoferrin-derived peptide possessing binding activity to hepatitis C virus E2 envelope protein. Identification of a lactoferrin-derived peptide possessing binding activity to hepatitis C virus E2 envelope protein. J. Biol. Chem. (0021-9258) 2003 imex curation Nozaki A., Ikeda M., Naganuma A., Nakamura T., Inudoh M., Tanaka K., Kato N. Virus - Publications including interactions involving viral proteins nkato@md.okayama-u.ac.jp Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Nozaki A., Ikeda M., Naganuma A., Nakamura T., Inudoh M., Tanaka K., Kato N. Virus - Publications including interactions involving viral proteins nkato@md.okayama-u.ac.jp Accepted 2015-MAR-19 by PPORRAS J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation p27958-pro_0000037570 Envelope glycoprotein E2 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) ETHVTGGNAGRTTAGLVGLLTPGAKQNIQLINTNGSWHINSTALNCNESLNTGWLAGLFYQHKFNSSGCPERLASCRRLTDFAQGWGPISYANGSGLDERPYCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGANDTDVFVLNNTRPPLGNWFGCTWMNSTGFTKVCGAPPCVIGGVGNNTLLCPTDCFRKYPEATYSRCGSGPRITPRCMVDYPYRLWHYPCTINYTIFKVRMYVGGVEHRLEAACNWTRGERCDLEDRDRSELSPLLLSTTQWQVLPCSFTTLPALSTGLIHLHQNIVDVQYLYGVGSSIASWAIKWEYVVLLFLLLADARVCSCLWMMLLISQAEA 384 746 9243E2103B6CCA2D trfl_horse Lactotransferrin LTF protein protein horse Equus caballus (Horse) Horse LGLCLAAPRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEADRDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWRLLHRAQEEFGRNKSSAFQLFKSTPENKDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA 07BB84D50E1B165D trfl_human Lactotransferrin LTF LF Talalactoferrin GIG12 Growth-inhibiting protein 12 protein protein human Homo sapiens Human MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAARRARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYTAGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHTAVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNSNERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRKPVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSPLLEACEFLRK DIP protein P02788 original sequence version: 141 DIP protein P02788 original sequence version: 187 0489CABA6D13C098 cd81_human CD81 antigen 26 kDa cell surface protein TAPA-1 Target of the antiproliferative antibody 1 Tetraspanin-28 CD81 TAPA1 TSPAN28 protein protein human Homo sapiens Human MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY EB9BD7671AC91B4A trfl_bovin Lactotransferrin LTF protein protein bovin Bos taurus (Bovine) Bovine MKLFVPALLSLGALGLCLAAPRKNVRWCTISQPEWFKCRRWQWRMKKLGAPSITCVRRAFALECIRAIAEKKADAVTLDGGMVFEAGRDPYKLRPVAAEIYGTKESPQTHYYAVAVVKKGSNFQLDQLQGRKSCHTGLGRSAGWIIPMGILRPYLSWTESLEPLQGAVAKFFSASCVPCIDRQAYPNLCQLCKGEGENQCACSSREPYFGYSGAFKCLQDGAGDVAFVKETTVFENLPEKADRDQYELLCLNNSRAPVDAFKECHLAQVPSHAVVARSVDGKEDLIWKLLSKAQEKFGKNKSRSFQLFGSPPGQRDLLFKDSALGFLRIPSKVDSALYLGSRYLTTLKNLRETAEEVKARYTRVVWCAVGPEEQKKCQQWSQQSGQNVTCATASTTDDCIVLVLKGEADALNLDGGYIYTAGKCGLVPVLAENRKSSKHSSLDCVLRPTEGYLAVAVVKKANEGLTWNSLKDKKSCHTAVDRTAGWNIPMGLIVNQTGSCAFDEFFSQSCAPGADPKSRLCALCAGDDQGLDKCVPNSKEKYYGYTGAFRCLAEDVGDVAFVKNDTVWENTNGESTADWAKNLNREDFRLLCLDGTRKPVTEAQSCHLAVAPNHAVVSRSDRAAHVKQVLLHQQALFGKNGKNCPDKFCLFKSETKNLLFNDNTECLAKLGGRPTYEEYLGTEYVTAIANLKKCSTSPLLEACAFLTR mint Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate The lactotransferrin peptidase S60 domain 1 functions as a serine protease that cuts arginine rich regions. This function contributes to the antimicrobial activity homomint Lactotransferrin has antimicrobial activity. The most effective inhibitory activity was seen against E.coli and P.aeruginosa Lactoferricin B is an antimicrobial peptide. Inhibits the growth of Gram-negative and Gram-positive bacteria C6FD7FC15D68E93F null-ltf-1 1 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trx tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Fig. 4 e2-ltf-2 1 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trx tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Fig. 4 e2-ltf-1 1 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trx tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Deglycosylation of LF resulted in intensified E2 protein binding activity. Fig. 4, 5D, 5E, 6B, 7B and 8D e2-cd81-1 1 4 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trx tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Deglycosylation of LF resulted in intensified E2 protein binding activity. Fig. 5E e2-lf-2 1 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig. 8 e2-lf-3 2 6 unspecified role unspecified role prey prey mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Fig. 9 e2-lf-4 1 6 unspecified role unspecified role prey prey P02788:p.Glu626Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain true E A Wed May 02 17:02:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu626ala' Tue Jun 30 17:10:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu626Ala' P02788:p.Arg627Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain true R A Wed May 02 19:38:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg627ala' Tue Jun 30 17:37:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg627Ala' P02788:p.Gln630Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain true Q A Wed May 02 14:47:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln630ala' Tue Jun 30 17:32:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln630Ala' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain true trx tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true P02788:p.Leu628Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain true L A Wed May 02 17:09:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu628ala' Tue Jun 30 16:59:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu628Ala' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain true P02788:p.Lys629Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain true K A Wed May 02 14:32:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys629ala' Tue Jun 30 18:46:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys629Ala' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain true direct interaction direct interaction Fig. 3C e2-lf-1 3 8 unspecified role unspecified role prey prey mesau Mesocricetus auratus (Golden hamster) Golden hamster 4 unspecified role unspecified role bait bait cell lysate cell lysate region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain true crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Fig. 1 and 2B p27958_pro-ltf-1 3 4 unspecified role unspecified role bait bait cell lysate cell lysate region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain true crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 6 unspecified role unspecified role prey prey mesau Mesocricetus auratus (Golden hamster) Golden hamster physical association physical association Fig. 1, 2B