MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Identification of casein kinase Ialpha interacting protein partners. Identification of casein kinase Ialpha interacting protein partners. FEBS Lett. (0014-5793) 2002 Dubois T., Howell S., Zemlickova E., Aitken A. Virus - Publications including interactions involving viral proteins no thierry.dubois@curie.fr rapid curation in vivo in vivo imaging technique imaging technique microscopy predetermined predetermined participant predetermined Dubois T., Howell S., Zemlickova E., Aitken A. Virus - Publications including interactions involving viral proteins no thierry.dubois@curie.fr FEBS Lett. (0014-5793) 2002 rapid curation Identification of casein kinase Ialpha interacting protein partners. Identification of casein kinase Ialpha interacting protein partners. FEBS Lett. (0014-5793) 2002 Dubois T., Howell S., Zemlickova E., Aitken A. Virus - Publications including interactions involving viral proteins no thierry.dubois@curie.fr rapid curation in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Dubois T., Howell S., Zemlickova E., Aitken A. Virus - Publications including interactions involving viral proteins no thierry.dubois@curie.fr FEBS Lett. (0014-5793) 2002 rapid curation Identification of casein kinase Ialpha interacting protein partners. Identification of casein kinase Ialpha interacting protein partners. FEBS Lett. (0014-5793) 2002 Dubois T., Howell S., Zemlickova E., Aitken A. Virus - Publications including interactions involving viral proteins no thierry.dubois@curie.fr rapid curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Dubois T., Howell S., Zemlickova E., Aitken A. Virus - Publications including interactions involving viral proteins no thierry.dubois@curie.fr FEBS Lett. (0014-5793) 2002 rapid curation Identification of casein kinase Ialpha interacting protein partners. Identification of casein kinase Ialpha interacting protein partners. FEBS Lett. (0014-5793) 2002 Dubois T., Howell S., Zemlickova E., Aitken A. Virus - Publications including interactions involving viral proteins no thierry.dubois@curie.fr rapid curation in vivo in vivo experimental interac experimental interaction detection experimental interac nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Dubois T., Howell S., Zemlickova E., Aitken A. Virus - Publications including interactions involving viral proteins no thierry.dubois@curie.fr FEBS Lett. (0014-5793) 2002 rapid curation syt11_human Synaptotagmin-11 Synaptotagmin XI SYT11 KIAA0080 protein protein human Homo sapiens Human MAEITNIRPSFDVSPVVAGLIGASVLVVCVSVTVFVWSCCHQQAEKKQKNPPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLTPGESKTTSPSSPEEDVMLGSLTFSVDYNFPKKALVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCISRGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKCTLNPIFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTASGAEHWREVCESPRKPVAKWHSLSEY 5C8667D2C23D758E adap1_human Arf-GAP with dual PH domain-containing protein 1 Putative MAPK-activating protein PM25 ADAP1 CENTA1 Centaurin-alpha-1 protein protein human Homo sapiens Human MAKERRRAVLELLQRPGNARCADCGAPDPDWASYTLGVFICLSCSGIHRNIPQVSKVKSVRLDAWEEAQVEFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRGRDNGQFLSRKFVLTEREGALKYFNRNDAKEPKAVMKIEHLNATFQPAKIGHPHGLQVTYLKDNSTRNIFIYHEDGKEIVDWFNALRAARFHYLQVAFPGAGDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPHGITIVTPDRKFLFACETESDQREWVAAFQKAVDRPMLPQEYAVEAHFKHKP DIP protein O75689 original sequence version: 92 38547281FB09D9B9 erf1_human Eukaryotic peptide chain release factor subunit 1 ETF1 ERF1 Protein Cl1 RF1 SUP45L1 TB3-1 protein protein human Homo sapiens Human MADDPSAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKLYNKVPPNGLVVYCGTIVTEEGKEKKVNIDFEPFKPINTSLYLCDNKFHTEALTALLSDDSKFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKVAETAVQLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVLSNVKFIQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY CECC50D100E59D19 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63104 original sequence version: 144 D464DF2286BBFE60 hmgb2_human High mobility group protein B2 HMGB2 HMG2 High mobility group protein 2 protein protein human Homo sapiens Human MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE 5E65292BC4AD8373 kc1a_human Casein kinase I isoform alpha CSNK1A1 CK1 protein protein human Homo sapiens Human MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF DIP protein P48729 original sequence version: 92 DIP protein P48729 original sequence version: 171 DIP protein P48729 original sequence version: 163 1B2085AE33CAFAC2 erf_human ETS domain-containing transcription factor ERF ERF Ets2 repressor factor PE-2 protein protein human Homo sapiens Human MKTPADTGFAFPDWAYKPESSPGSRQIQLWHFILELLRKEEYQGVIAWQGDYGEFVIKDPDEVARLWGVRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKLVLVNYPFIDVGLAGGAVPQSAPPVPSGGSHFRFPPSTPSEVLSPTEDPRSPPACSSSSSSLFSAVVARRLGRGSVSDCSDGTSELEEPLGEDPRARPPGPPDLGAFRGPPLARLPHDPGVFRVYPRPRGGPEPLSPFPVSPLAGPGSLLPPQLSPALPMTPTHLAYTPSPTLSPMYPSGGGGPSGSGGGSHFSFSPEDMKRYLQAHTQSVYNYHLSPRAFLHYPGLVVPQPQRPDKCPLPPMAPETPPVPSSASSSSSSSSSPFKFKLQPPPLGRRQRAAGEKAVAGADKSGGSAGGLAEGAGALAPPPPPPQIKVEPISEGESEEVEVTDISDEDEEDGEVFKTPRAPPAPPKPEPGEAPGASQCMPLKLRFKRRWSEDCRLEGGGGPAGGFEDEGEDKKVRGEGPGEAGGPLTPRRVSSDLQHATAQLSLEHRDS mint Potent transcriptional repressor that binds to the H1 element of the Ets2 promoter. May regulate other genes involved in cellular proliferation 01242339B8D328ED pp14a_human Protein phosphatase 1 regulatory subunit 14A CPI17 PPP1INL 17 kDa PKC-potentiated inhibitory protein of PP1 Protein kinase C-potentiated inhibitor protein of 17 kDa PPP1R14A protein protein human Homo sapiens Human MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRLEELYRGMEADMPDEINIDELLELESEEERSRKIQGLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLSPLQDRARTAHP 470EE2C082FF7319 ima5_human Importin subunit alpha-5 KPNA1 RCH2 Karyopherin subunit alpha-1 SRP1-beta RAG cohort protein 2 Nucleoprotein interactor 1 protein protein human Homo sapiens Human MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL DIP protein P52294 original sequence version: 72 DIP protein P52294 original sequence version: 90 DIP protein P52294 original sequence version: 112 DIP protein P52294 original sequence version: 160 E8407A3352D6051C hmgb1_human High mobility group protein B1 HMGB1 HMG1 High mobility group protein 1 protein protein human Homo sapiens Human MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE DIP protein P09429 original sequence version: 141 8A868CF277D417B5 rcc1_human Regulator of chromosome condensation Chromosome condensation protein 1 Cell cycle regulatory protein RCC1 CHC1 protein protein human Homo sapiens Human MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS DIP protein P18754 original sequence version: 117 F6D225AF81928305 q63629_rat protein protein rat Rattus norvegicus (Rat) Rat MAGELRRALLELLTRPGNSRCADCGAPDPDWASYTLGVFICLSCSGIHRNIPQVSKVKSVRLDAWDETQVEFMTSHGNEAARATFESKVPPFYYRPTFSDCQLLREQWIRAKYERQEFLHVEKQEPYSTGYREGLLWKGGGPGQWTVLKSEVCADRTRGWRLKYFNKNDAKEPKAVMKIEHLNATFQPAKIGHPHGLQVTYLKDNSTRNIFIYHEDGKEIVDWFNALRAARFHYLQVAFPGASDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIGSKESGYTVLEGLPPSTQSHHWPHGITIVTPDRKFLFTCETESDQREWIAAFQKVVDRPMLPQEYAVEAHFKHINPKEESPEAPGFCTRVAAQLDSRRAYVPRCGPGMARWGSGKPIR mint 45FA50E2D2450D7A csnk1a1-adap1-1 1 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint mint csnk1a1-etf1 1 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint mint csnk1a1-hmgb1 1 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-716712: original sequence: 233-271 : YEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEE Stoichiometry: 1.0 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint mint csnk1a1-rcc1 1 15 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint mint csnk1a1-ppp1r14a 1 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 12 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint mint csnk1a1-hmgb2 1 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint mint csnk1a1-syt11 1 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint mint csnk1a1-adap1-2 3 16 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 10 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-716602: original sequence: 217-233 : TSLPWQGLKAATKKQK Stoichiometry: 1.0 direct interaction direct interaction mint csnk1a1-kpna1 3 13 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 10 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-716630: original sequence: 217-233 : TSLPWQGLKAATKKQK Stoichiometry: 1.0 direct interaction direct interaction homomint mint csnk1a1-adap1-3 2 16 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-716694: original sequence: 217-233 : TSLPWQGLKAATKKQK Stoichiometry: 1.0 physical association physical association mint csnk1a1-rcc1-1 2 15 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint mint csnk1a1-rcc1-2 2 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association homomint mint csnk1a1-ppp1r14a-1 2 12 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint mint csnk1a1-hmgb2-1 2 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint mint csnk1a1-hmgb1-1 2 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-716722: original sequence: 217-233 : TSLPWQGLKAATKKQK Stoichiometry: 1.0 physical association physical association homomint mint csnk1a1-erf 2 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint mint csnk1a1-ywhaz-1 4 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation homomint domino mint