HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Mycobacterium tuberculosis WhiB3 interacts with RpoV to affect host survival but is dispensable for in vivo growth. Mycobacterium tuberculosis WhiB3 interacts with RpoV to affect host survival but is dispensable for in vivo growth. Proceedings of the National Academy of Sciences of the United States of America 2002 imex curation Steyn AJ., Collins DM., Hondalus MK., Jacobs WR., Kawakami RP., Bloom BR., Steyn AJ., Collins DM., Hondalus MK., Jacobs WR., Kawakami RP., Bloom BR. Virus - Publications including interactions involving viral proteins bbloom@hsph.harvard.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Steyn AJ., Collins DM., Hondalus MK., Jacobs WR., Kawakami RP., Bloom BR. Virus - Publications including interactions involving viral proteins bbloom@hsph.harvard.edu Accepted 2016-AUG-10 AT 08:16 BST AT 08:16 BST by MGT Proceedings of the National Academy of Sciences of the United States of America 2002 imex curation Mycobacterium tuberculosis WhiB3 interacts with RpoV to affect host survival but is dispensable for in vivo growth. Mycobacterium tuberculosis WhiB3 interacts with RpoV to affect host survival but is dispensable for in vivo growth. Proceedings of the National Academy of Sciences of the United States of America 2002 imex curation Steyn AJ., Collins DM., Hondalus MK., Jacobs WR., Kawakami RP., Bloom BR., Steyn AJ., Collins DM., Hondalus MK., Jacobs WR., Kawakami RP., Bloom BR. Virus - Publications including interactions involving viral proteins bbloom@hsph.harvard.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Steyn AJ., Collins DM., Hondalus MK., Jacobs WR., Kawakami RP., Bloom BR. Virus - Publications including interactions involving viral proteins bbloom@hsph.harvard.edu Accepted 2016-AUG-10 AT 08:16 BST AT 08:16 BST by MGT H37Rv yeast two-hybrid library Proceedings of the National Academy of Sciences of the United States of America 2002 imex curation Mycobacterium tuberculosis WhiB3 interacts with RpoV to affect host survival but is dispensable for in vivo growth. Mycobacterium tuberculosis WhiB3 interacts with RpoV to affect host survival but is dispensable for in vivo growth. Proceedings of the National Academy of Sciences of the United States of America 2002 imex curation Steyn AJ., Collins DM., Hondalus MK., Jacobs WR., Kawakami RP., Bloom BR., Steyn AJ., Collins DM., Hondalus MK., Jacobs WR., Kawakami RP., Bloom BR. Virus - Publications including interactions involving viral proteins bbloom@hsph.harvard.edu 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro seldi chip proteinchip(r) on a surface-enhanced laser desorption/ionization SELDI ProteinChip seldi chip ms participant Identification by mass spectrometry ms participant Steyn AJ., Collins DM., Hondalus MK., Jacobs WR., Kawakami RP., Bloom BR. Virus - Publications including interactions involving viral proteins bbloom@hsph.harvard.edu Accepted 2016-AUG-10 AT 08:16 BST AT 08:16 BST by MGT Proceedings of the National Academy of Sciences of the United States of America 2002 imex curation siga_myctu RNA polymerase sigma factor SigA sigA mysA rpoD rpoV MTCY05A6.24 Rv2703 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MAATKASTATDEPVKRTATKSPAASASGAKTGAKRTAAKSASGSPPAKRATKPAARSVKPASAPQDTTTSTIPKRKTRAAAKSAAAKAPSARGHATKPRAPKDAQHEAATDPEDALDSVEELDAEPDLDVEPGEDLDLDAADLNLDDLEDDVAPDADDDLDSGDDEDHEDLEAEAAVAPGQTADDDEEIAEPTEKDKASGDFVWDEDESEALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELAKRIEAGLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSLAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELAKEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLD 2252FD53419EA8B8 whib3_myctu Redox- and pH-responsive transcriptional regulator WhiB3 whiB3 Rv3416 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MPQPEQLPGPNADIWNWQLQGLCRGMDSSMFFHPDGERGRARTQREQRAKEMCRRCPVIEACRSHALEVGEPYGVWGGLSESERDLLLKGTMGRTRGIRRTA C38A6774457F71BA rpov-whib3-1 1 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P9WGI1:p.Arg515His mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R H Wed May 02 17:36:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg515his' Tue Jun 30 17:38:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg515His' 5 unspecified role unspecified role prey prey physical association physical association 1C siga-whib3-1 3 5 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction 2 siga-whib3-2 2 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey physical association physical association no figure