HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Detection of a novel unglycosylated form of hepatitis C virus E2 envelope protein that is located in the cytosol and interacts with PKR. Detection of a novel unglycosylated form of hepatitis C virus E2 envelope protein that is located in the cytosol and interacts with PKR. J. Virol. (0022-538X) 2002 imex curation Pavio N., Taylor D.R., Lai M.M. Virus - Publications including interactions involving viral proteins michlai@hsc.usc.edu 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pavio N., Taylor D.R., Lai M.M. Virus - Publications including interactions involving viral proteins michlai @hsc.usc.edu michlai@hsc.usc.edu Accepted 2013-AUG-12 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2002 imex curation o92972-pro_0000278746 Envelope glycoprotein E2 protein protein hcvj4 Hepatitis C virus genotype 1b (strain HC-J4) (HCV) ETHTTGRVAGHTTSGFTSLFSSGASQKIQLVNTNGSWHINRTALNCNDSLQTGFFAALFYAHKFNSSGCPERMASCRPIDWFAQGWGPITYTKPNSSDQRPYCWHYAPRPCGVVPASQVCGPVYCFTPSPVVVGTTDRSGVPTYSWGENETDVMLLNNTRPPQGNWFGCTWMNSTGFTKTCGGPPCNIGGVGNRTLICPTDCFRKHPEATYTKCGSGPWLTPRCLVDYPYRLWHYPCTLNFSIFKVRMYVGGVEHRLNAACNWTRGERCNLEDRDRSELSPLLLSTTEWQILPCAFTTLPALSTGLIHLHQNIVDVQYLYGVGSAFVSFAIKWEYILLLFLLLADARVCACLWMMLLIAQAEA 384 746 3865429B0DEB628F e2ak2_human Interferon-induced, double-stranded RNA-activated protein kinase Interferon-inducible RNA-dependent protein kinase Eukaryotic translation initiation factor 2-alpha kinase 2 Protein kinase RNA-activated p68 kinase P1/eIF-2A protein kinase EIF2AK2 PKR PRKR Tyrosine-protein kinase EIF2AK2 protein protein human Homo sapiens Human MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSGSFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAKRSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC DIP protein P19525 original sequence version: 164 DIP protein P19525-1 original sequence version: 177 DIP protein P19525-1 original sequence version: 178 DIP protein P19525-1 original sequence version: 170 DIP protein P19525 original sequence version: 153 815AD83ACAB45DA3 e2-pkr-2 1 PKR 3 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. E2 2 unspecified role unspecified role bait bait human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. unglycosylated E2-p38 physical association physical association Fig. 6 e2-pkr-3 1 PKR 3 unspecified role unspecified role bait bait human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. E2 2 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. unglycosylated E2-p38 physical association physical association Fig. 6