MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The conserved Mynd domain of BS69 binds cellular and oncoviral proteins through a common PXLXP motif. The conserved Mynd domain of BS69 binds cellular and oncoviral proteins through a common PXLXP motif. J. Biol. Chem. (0021-9258) 2002 Ansieau S., Leutz A. Virus - Publications including interactions involving viral proteins ansieu@mdc-berlin.de human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ansieau S., Leutz A. Virus - Publications including interactions involving viral proteins ansieu@mdc-berlin.de J. Biol. Chem. (0021-9258) 2002 The conserved Mynd domain of BS69 binds cellular and oncoviral proteins through a common PXLXP motif. The conserved Mynd domain of BS69 binds cellular and oncoviral proteins through a common PXLXP motif. J. Biol. Chem. (0021-9258) 2002 Ansieau S., Leutz A. Virus - Publications including interactions involving viral proteins ansieu@mdc-berlin.de in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ansieau S., Leutz A. Virus - Publications including interactions involving viral proteins ansieu@mdc-berlin.de J. Biol. Chem. (0021-9258) 2002 The conserved Mynd domain of BS69 binds cellular and oncoviral proteins through a common PXLXP motif. The conserved Mynd domain of BS69 binds cellular and oncoviral proteins through a common PXLXP motif. J. Biol. Chem. (0021-9258) 2002 Ansieau S., Leutz A. Virus - Publications including interactions involving viral proteins ansieu@mdc-berlin.de human-qt_6 Homo sapiens qt_6 Quail Japanese fibrosarcoma anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ansieau S., Leutz A. Virus - Publications including interactions involving viral proteins ansieu@mdc-berlin.de J. Biol. Chem. (0021-9258) 2002 zmy11_human Zinc finger MYND domain-containing protein 11 BRAM1 Bone morphogenetic protein receptor-associated molecule 1 ZMYND11 Adenovirus 5 E1A-binding protein BS69 Protein BS69 protein protein human Homo sapiens Human MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEEPEPETEAVSSSQEIPTMPQPIEKVSVSTQTKKLSASSPRMLHRSTQTTNDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFVEEIKKLATQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR 3AD525B90574BDE8 ebna2_ebvb9 Epstein-Barr nuclear antigen 2 EBNA2 BYRF1 protein protein ebvb9 Epstein-Barr virus (strain B95-8) (HHV-4) Human herpesvirus 4 HHV-4 MPTFYLALHGGQTYHLIVDTDSLGNPSLSVIPSNPYQEQLSDTPLIPLTIFVGENTGVPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQRRDAWTQEPSPLDRDPLGYDVGHGPLASAMRMLWMANYIVRQSRGDRGLILPQGPQTAPQARLVQPHVPPLRPTAPTILSPLSQPRLTPPQPLMMPPRPTPPTPLPPATLTVPPRPTRPTTLPPTPLLTVLQRPTELQPTPSPPRMHLPVLHVPDQSMHPLTHQSTPNDPDSPEPRSPTVFYNIPPMPLPPSQLPPPAAPAQPPPGVINDQQLHHLPSGPPWWPPICDPPQPSKTQGQSRGQSRGRGRGRGRGRGKGKSRDKQRKPGGPWRPEPNTSSPSMPELSPVLGLHQGQGAGDSPTPGPSNAAPVCRNSHTATPNVSPIHEPESHNSPEAPILFPDDWYPPSIDPADLDESWDYIFETTESPSSDEDYVEGPSKRPRPSIQ DIP protein P12978 original sequence version: 92 mint Involved in latent cycle. Transactivates the expression of LMP-1 DEF40D7F8ED61D1A e1a_ade05 Early E1A protein Early E1A 32 kDa protein protein protein ade05 Human adenovirus C serotype 5 (HAdV-5) HAdV-5 Human adenovirus 5 MRHIICHGGVITEEMAASLLDQLIEEVLADNLPPPSHFEPPTLHELYDLDVTAPEDPNEEAVSQIFPDSVMLAVQEGIDLLTFPPAPGSPEPPHLSRQPEQPEQRALGPVSMPNLVPEVIDLTCHEAGFPPSDDEDEEGEEFVLDYVEHPGHGCRSCHYHRRNTGDPDIMCSLCYMRTCGMFVYSPVSEPEPEPEPEPEPARPTRRPKMAPAILRRPTSPVSRECNSSTDSCDSGPSNTPPEIHPVVPLCPIKPVAVRVGGRRQAVECIEDLLNEPGQPLDLSCKRPRP DIP protein P03255 original sequence version: 73 DIP protein P03255 original sequence version: 110 8C5997A3908C40D7 q20747_caeel F54B11.11 CELE_F54B11.11 protein protein caeel Caenorhabditis elegans MLLKSTIFLFFLDIVHAQIGAQCQSRTVNVTSIQGTIPYPSVNLVKIDQWESCYYNFIIPLGYALQFQISYTMDKGDVLTITNSLGVTVGFTNFTGVQKDVYWCTAGDSTLRVTSFSGNLAFLISYQFYSLKSYFPLMRYSGDYFQVSQIPPAQYLIFYGSKLALTLAANTAAESLKNLDRYMLYIGTDVMQYPASGTLADLINGTQFYDNGRMYYANWITIVNFYDDFKSDAYIIANDGPEITSSYQFFITPPNNFTSKVLFDVTDGGGAVTFACPDCTNFYINQLVFDTMLTSPNGYIAFQGNTPSQIYMAKVINYNATSFNPNQLPQIIPTNKFTLLMYKSLFTIELYSGDEYSAWKQPRVGRTGLISSVSLWETVWDSATFQYEIRDDSQLYNFNVNIDNMNFTGVNFLNLCIGSGPGYNNQVNLTYPPALNSSVTSIGNYLTTSANFTMRGYITLYYEITAASGTTTQPILSTMTSSTTKTLTSTTTITTTKANILTTTATTTTPPVTSAPATTFITPVPFTPPVTNSTTIYSSNTGSTLSTTIGLPITQVSVQTTTQTAPLKVVLLNVLSFVLIAELFKNLL mint A309DC08734F7F83 taf1b_caeel TATA box-binding protein-associated factor RNA polymerase I subunit B TATA box-binding protein-associated factor 1B F23H11.2 protein protein caeel Caenorhabditis elegans MHSAKNEKCNACGGYRFSVNDGFKYCDRCGALFENFEELEEEEGGLQQTVGQGKVKVRKNDDQKRVRNNAAPVNLPKAQVMREALEKRSDFLQQQAIKGEELELPHDATPDYLYRLALRLFSFTQILAKSGHILVHELNFESRVQENILATFQKYLAHCQVAFCHSEQCGNDEHLRFVAVMENLRYEQEEREEKQRKRMAKRGKGVNALSKSAAAWTLLTQGNITEHLDIASDEDGDQDAQGGQQLDDLTLETTQNPDESIRVNDTTMGFVRKVTTALSKEALRRASQLILNLEMLVAILHSALMSSGYQTILTSDVVRWIREDRFRISRRSIRLIRQSQPERMKQGEVVKPTIVDYAEPFLRFPLYEIMRTCTIFHQSLKLASSMAPQSFESMSARLVDNLNLPSDILSRMLILESIIPCDVSPQLLKQVDVDMGYNCGQLAAMSPNVYYSGFLTSFGRKERGTQDADFCDEVLLSPDAKLIAYLLLTLRLTFQLDNAQCALQDDQYFDVDSWIHQLEMRIKCWQGHNMSLVMRSSSHVPEMVVDPPFGTNYLFHQEKGAPQVSCRRRQAGFQKCIPTEMSFNSTSTLPTVFDVRHMGLLTERCQMEALISPVKFQRTVLGNEIERDPLTFENVDRQSKNTFFKHFSAFKTTESCDTFEEYFPCAKNYLLFKRPDWIQNCTARQTHFNPVTGPIRFYLSNQSCDDLLGTAATSFSRRFQFLLDALSLIIGEDKKAVYAAFVMLEMHLTSSERIQSIRDDLLTSSPITLKCQKFRNSTHHIPRKYGVISEVPIDRIENLRYFRLSRQFFEHEEMPTTINMELIDYRNQEIRDSVTETEVQRAQNRIMKLCYEFEQFFGILAVKFW E76410E76E6C3AD8 p03255-2 Early E1A protein Early E1A 32 kDa protein 243R S-E1A protein protein ade05 Human adenovirus C serotype 5 (HAdV-5) HAdV-5 Human adenovirus 5 MRHIICHGGVITEEMAASLLDQLIEEVLADNLPPPSHFEPPTLHELYDLDVTAPEDPNEEAVSQIFPDSVMLAVQEGIDLLTFPPAPGSPEPPHLSRQPEQPEQRALGPVSMPNLVPEVIDLTCHEAGFPPSDDEDEEGPVSEPEPEPEPEPEPARPTRRPKMAPAILRRPTSPVSRECNSSTDSCDSGPSNTPPEIHPVVPLCPIKPVAVRVGGRRQAVECIEDLLNEPGQPLDLSCKRPRP No experimental confirmation available. CA355781A92A4D42 zmynd11-e1a 2 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2983757: original sequence: 86-128 : APGSPEPPHLSRQPEQPEQRALGPVSMPNLVPEVIDLTCHEA Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:05:12 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Cys523Ser range MINT-2576155: original sequence: 523-523 : LISQTKKKQWCYNCEEEAMY binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2576152: original sequence: 518-562 : KKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRK Stoichiometry: 1.0 physical association physical association F1B F2A homomint mint zmynd11-ebna2 2 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2583870: original sequence: 379-439 : SPSMPELSPVLGLHQGQGAGDSPTPGPSNAAPVCRNSHTATPNVSPIHEPESHNSPEAPI Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:04:42 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Cys523Ser range MINT-2576539: original sequence: 523-523 : LISQTKKKQWCYNCEEEAMY undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:04:39 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 411-517 range MINT-2576542: original sequence: 411-517 : LHRSTQTTNDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFVEEIKKLATQHKQLISQ binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2576544: original sequence: 411-562 : LHRSTQTTNDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFVEEIKKLATQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRK Stoichiometry: 1.0 physical association physical association F1B F2B homomint mint q20747-e1a 2 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2578426: original sequence: 117-163 : SGNLAFLISYQFYSLKSYFPLMRYSGDYFQVSQIPPAQYLIFYGSK gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 physical association physical association F1E mint q20747-ebna2 2 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2578615: original sequence: 117-163 : SGNLAFLISYQFYSLKSYFPLMRYSGDYFQVSQIPPAQYLIFYGSK Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 physical association physical association F1E mint taf1b-ebna2 2 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2578703: original sequence: 144-189 : VQENILATFQKYLAHCQVAFCHSEQCGNDEHLRFVAVMENLRYEQ Stoichiometry: 1.0 physical association physical association F1E mint taf1b-e1a 2 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2578742: original sequence: 144-189 : VQENILATFQKYLAHCQVAFCHSEQCGNDEHLRFVAVMENLRYEQ Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 physical association physical association F1E mint e1a-zmynd11-1 3 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:50:39 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Cys523Ser range MINT-2577214: original sequence: 523-523 : LISQTKKKQWCYNCEEEAMY binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2577219: original sequence: 411-562 : LHRSTQTTNDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFVEEIKKLATQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRK Stoichiometry: 1.0 6 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P03255:p.Leu115Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:12:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:05:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu115ala' Tue Jun 30 19:29:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu115Ala' range MINT-2583879: original sequence: 115-115 : RALGPVSMPNLVPEVIDLTC Stoichiometry: 1.0 physical association physical association F3A F1C homomint mint p03255_2-zmynd11 3 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2583898: original sequence: 411-562 : LHRSTQTTNDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFVEEIKKLATQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRK Stoichiometry: 1.0 9 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P03255-2:p.Leu115Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:10:45 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:30:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu115ala' Tue Jun 30 18:47:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu115Ala' range MINT-2583888: original sequence: 115-115 : RALGPVSMPNLVPEVIDLTC Stoichiometry: 1.0 physical association physical association F3A homomint mint zmynd11-ebna2-1 1 5 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 4 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1D homomint mint