MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Detection of protein-protein interactions among lens crystallins in a mammalian two-hybrid system assay. Detection of protein-protein interactions among lens crystallins in a mammalian two-hybrid system assay. J. Biol. Chem. (0021-9258) 2002 Fu L., Liang JJ. Virus - Publications including interactions involving viral proteins in vitro In vitro pull down pull down predetermined predetermined participant predetermined Fu L., Liang JJ. Virus - Publications including interactions involving viral proteins no J. Biol. Chem. (0021-9258) 2002 Detection of protein-protein interactions among lens crystallins in a mammalian two-hybrid system assay. Detection of protein-protein interactions among lens crystallins in a mammalian two-hybrid system assay. J. Biol. Chem. (0021-9258) 2002 Fu L., Liang JJ. Virus - Publications including interactions involving viral proteins in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Fu L., Liang JJ. Virus - Publications including interactions involving viral proteins no J. Biol. Chem. (0021-9258) 2002 Detection of protein-protein interactions among lens crystallins in a mammalian two-hybrid system assay. Detection of protein-protein interactions among lens crystallins in a mammalian two-hybrid system assay. J. Biol. Chem. (0021-9258) 2002 Fu L., Liang JJ. Virus - Publications including interactions involving viral proteins in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Fu L., Liang JJ. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 2002 Detection of protein-protein interactions among lens crystallins in a mammalian two-hybrid system assay. Detection of protein-protein interactions among lens crystallins in a mammalian two-hybrid system assay. J. Biol. Chem. (0021-9258) 2002 Fu L., Liang JJ. Virus - Publications including interactions involving viral proteins in vitro In vitro experimental interac experimental interaction detection experimental interac predetermined predetermined participant predetermined Fu L., Liang JJ. Virus - Publications including interactions involving viral proteins no J. Biol. Chem. (0021-9258) 2002 Detection of protein-protein interactions among lens crystallins in a mammalian two-hybrid system assay. Detection of protein-protein interactions among lens crystallins in a mammalian two-hybrid system assay. J. Biol. Chem. (0021-9258) 2002 Fu L., Liang JJ. Virus - Publications including interactions involving viral proteins in vivo in vivo beta lactamase beta lactamase complementation beta lactamase nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Fu L., Liang JJ. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 2002 cryaa_human Alpha-crystallin A chain CRYAA CRYA1 HSPB4 Heat shock protein beta-4 protein protein human Homo sapiens Human MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS DIP protein P02489 original sequence version: 121 DIP protein P02489 original sequence version: 131 81804A8439837D50 crgc_human Gamma-crystallin C CRYGC CRYG3 Gamma-C-crystallin Gamma-crystallin 2-1 Gamma-crystallin 3 protein protein human Homo sapiens Human MGKITFYEDRAFQGRSYETTTDCPNLQPYFSRCNSIRVESGCWMLYERPNYQGQQYLLRRGEYPDYQQWMGLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY B01DC167171A7668 cryab_human Alpha-crystallin B chain CRYAB CRYA2 Renal carcinoma antigen NY-REN-27 Alpha(B)-crystallin Rosenthal fiber component Heat shock protein beta-5 HSPB5 protein protein human Homo sapiens Human MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK DIP protein P02511 original sequence version: null AE08BED46B7849CB DIP protein P02511 original sequence version: 195 DIP protein P02511 original sequence version: 130 DIP protein P02511 original sequence version: 131 DIP protein P02511 original sequence version: 151 DIP protein P02511 original sequence version: 167 DIP protein P02511 original sequence version: 154 DIP protein P02511 original sequence version: 146 AE08BED46B7849CB hspb1_human Heat shock protein beta-1 HSPB1 HSP27 HSP28 Heat shock 27 kDa protein Stress-responsive protein 27 Estrogen-regulated 24 kDa protein 28 kDa heat shock protein protein protein human Homo sapiens Human MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK 1B4DC44A6F6606D5 1B4DC44A6F6606D5 crbb2_human Beta-crystallin B2 Beta-B2 crystallin Beta-crystallin Bp CRYBB2 CRYB2 CRYB2A protein protein human Homo sapiens Human MASDHQTQAGKPQSLNPKIIIFEQENFQGHSHELNGPCPNLKETGVEKAGSVLVQAGPWVGYEQANCKGEQFVFEKGEYPRWDSWTSSRRTDSLSSLRPIKVDSQEHKIILYENPNFTGKKMEIIDDDVPSFHAHGYQEKVSSVRVQSGTWVGYQYPGYRGLQYLLEKGDYKDSSDFGAPHPQVQSVRRIRDMQWHQRGAFHPSN FD95C354724A67D0 cryaa-crybb2 3 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association Technique: CAT assay homomint mint crygc-crybb2 3 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association Technique: CAT assay homomint mint crygc-cryab-3 3 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association Technique: CAT assay homomint mint crybb2-cryab-1 3 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association Technique: CAT assay homomint mint cryaa-crygc-3 3 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association Technique: CAT assay homomint mint crygc-crybb2-1 2 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association Technique: CAT assay homomint mint cryaa-crybb2-1 2 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association Technique: CAT assay homomint mint crygc-cryab-4 2 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association Technique: CAT assay homomint mint cryaa-cryab-4 2 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association Technique: CAT assay homomint mint crybb2-cryab-2 2 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association Technique: CAT assay homomint mint cryaa-crygc-4 2 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association Technique: CAT assay homomint mint hspb1-crybb2 1 10 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 9 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction homomint mint hspb1-cryab 1 8 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 9 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction homomint mint hspb1-cryaa 1 9 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 6 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction homomint mint cryaa-cryab-5 5 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association Technique: CAT assay homomint mint cryaa-crygc-5 4 7 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 6 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association Technique: CAT assay homomint mint crybb2-crygc-1 4 10 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 7 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association Technique: CAT assay homomint mint cryaa-crybb2-2 4 6 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 10 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association Technique: CAT assay homomint mint cryab-crygc-1 4 7 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 8 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association Technique: CAT assay homomint mint cryab-crybb2 4 10 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 8 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association Technique: CAT assay homomint mint cryaa-cryab-6 4 6 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 8 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association Technique: CAT assay homomint mint