MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Meltrin alpha cytoplasmic domain interacts with SH3 domains of Src and Grb2 and is phosphorylated by v-Src. Meltrin alpha cytoplasmic domain interacts with SH3 domains of Src and Grb2 and is phosphorylated by v-Src. Oncogene (0950-9232) 2000 Suzuki A., Kadota N., Hara T., Nakagami Y., Izumi T., Takenawa T., Sabe H., Endo T. Virus - Publications including interactions involving viral proteins no in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Suzuki A., Kadota N., Hara T., Nakagami Y., Izumi T., Takenawa T., Sabe H., Endo T. Virus - Publications including interactions involving viral proteins no Oncogene (0950-9232) 2000 Meltrin alpha cytoplasmic domain interacts with SH3 domains of Src and Grb2 and is phosphorylated by v-Src. Meltrin alpha cytoplasmic domain interacts with SH3 domains of Src and Grb2 and is phosphorylated by v-Src. Oncogene (0950-9232) 2000 Suzuki A., Kadota N., Hara T., Nakagami Y., Izumi T., Takenawa T., Sabe H., Endo T. Virus - Publications including interactions involving viral proteins no in vivo in vivo imaging technique imaging technique microscopy predetermined predetermined participant predetermined Suzuki A., Kadota N., Hara T., Nakagami Y., Izumi T., Takenawa T., Sabe H., Endo T. Virus - Publications including interactions involving viral proteins no Oncogene (0950-9232) 2000 Meltrin alpha cytoplasmic domain interacts with SH3 domains of Src and Grb2 and is phosphorylated by v-Src. Meltrin alpha cytoplasmic domain interacts with SH3 domains of Src and Grb2 and is phosphorylated by v-Src. Oncogene (0950-9232) 2000 Suzuki A., Kadota N., Hara T., Nakagami Y., Izumi T., Takenawa T., Sabe H., Endo T. Virus - Publications including interactions involving viral proteins no in vitro In vitro pull down pull down predetermined predetermined participant predetermined Suzuki A., Kadota N., Hara T., Nakagami Y., Izumi T., Takenawa T., Sabe H., Endo T. Virus - Publications including interactions involving viral proteins no Oncogene (0950-9232) 2000 grb2_mouse Growth factor receptor-bound protein 2 Grb2 Adapter protein GRB2 SH2/SH3 adapter GRB2 protein protein mouse Mus musculus Mouse MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQMPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV 97F4A4FE4B248DDF ada12_mouse Disintegrin and metalloproteinase domain-containing protein 12 Adam12 Mltna Meltrin-alpha protein protein mouse Mus musculus Mouse MAERPARRAPPARALLLALAGALLAPRAARGMSLWDQRGTYEVARASLLSKDPGIPGQSIPAKDHPDVLTVQLQLESRDLILSLERNEGLIANGFTETHYLQDGTDVSLTRNHTDHCYYHGHVQGDAASVVSLSTCSGLRGLIMFENKTYSLEPMKNTTDSYKLVPAESMTNIQGLCGSQHNKSNLTMEDVSPGTSQMRARRHKRETLKMTKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDIDKCSISQDPFTSLHEFLDWRKIKLLPRKSHDNAQLISGVYFQGTTIGMAPIMSMCTAEQSGGVVMDHSDSPLGAAVTLAHELGHNFGMNHDTLERGCSCRMAAEKGGCIMNPSTGFPFPMVFSSCSRKDLEASLEKGMGMCLFNLPEVKQAFGGRKCGNGYVEEGEECDCGEPEECTNRCCNATTCTLKPDAVCAHGQCCEDCQLKPPGTACRGSSNSCDLPEFCTGTAPHCPANVYLHDGHPCQGVDGYCYNGICQTHEQQCVTLWGPGAKPAPGICFERVNSAGDPYGNCGKDSKSAFAKCELRDAKCGKIQCQGGASRPVIGTNAVSIETNIPQQEGGRILCRGTHVYLGDDMPDPGLVLAGTKCAEGKICLNRRCQNISVFGVHKCAMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQADNQGLTVGILVSILCLLAAGFVVYLKRKTLMRLLFTHKKTTMEKLRCVHPSRTPSGPHLGQAHHTPGKGLLMNRAPHFNTPKDRHSLKCQNMDISRPLDARAVPQLQSPQRVLLPLHQTPRAPSGPARPLPASPAVRQAQGIRKPSPPQKPLPADPLSRTSRLTSALVRTPGQQEPGHRPAPIRPAPKHQVPRPSHNAYIK B6A1D0816E4A73FC adam12-grb2 3 5 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 4 unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-442866: original sequence: 1-57 : MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMK Stoichiometry: 1.0 direct interaction direct interaction Note that SH3 domain alone (aa 1-57) binds less strongly to ADAM than grb2 full lenght does. mint adam12-grb2-1 1 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-442880: original sequence: 1-57 : MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMK Stoichiometry: 1.0 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association Note that SH3 domain alone (aa 1-57) binds less strongly to ADAM than grb2 full lenght does. mint adam12-grb2-2 2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-442898: original sequence: 1-57 : MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMK Stoichiometry: 1.0 colocalization colocalization Note that SH3 domain alone (aa 1-57) binds less strongly to ADAM than grb2 full lenght does. mint