MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Phage display screening reveals an association between germline-specific transcription factor Oct-4 and multiple cellular proteins. Phage display screening reveals an association between germline-specific transcription factor Oct-4 and multiple cellular proteins. J. Mol. Biol. (0022-2836) 2000 rapid curation Butteroni C., De Felici M., Schöler HR., Pesce M. Virus - Publications including interactions involving viral proteins suggested by asmolyard rapid curation unknown Unknown anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Butteroni C., De Felici M., Schöler HR., Pesce M. Virus - Publications including interactions involving viral proteins suggested by asmolyard J. Mol. Biol. (0022-2836) 2000 rapid curation rapid curation Phage display screening reveals an association between germline-specific transcription factor Oct-4 and multiple cellular proteins. Phage display screening reveals an association between germline-specific transcription factor Oct-4 and multiple cellular proteins. J. Mol. Biol. (0022-2836) 2000 rapid curation Butteroni C., De Felici M., Schöler HR., Pesce M. Virus - Publications including interactions involving viral proteins suggested by asmolyard rapid curation unknown Unknown filamentous phage filamentous phage display filamentous phage predetermined predetermined participant predetermined Butteroni C., De Felici M., Schöler HR., Pesce M. Virus - Publications including interactions involving viral proteins suggested by asmolyard J. Mol. Biol. (0022-2836) 2000 rapid curation rapid curation Phage display screening reveals an association between germline-specific transcription factor Oct-4 and multiple cellular proteins. Phage display screening reveals an association between germline-specific transcription factor Oct-4 and multiple cellular proteins. J. Mol. Biol. (0022-2836) 2000 rapid curation Butteroni C., De Felici M., Schöler HR., Pesce M. Virus - Publications including interactions involving viral proteins suggested by asmolyard rapid curation unknown Unknown competition binding competition binding predetermined predetermined participant predetermined Butteroni C., De Felici M., Schöler HR., Pesce M. Virus - Publications including interactions involving viral proteins suggested by asmolyard J. Mol. Biol. (0022-2836) 2000 rapid curation rapid curation e1a_ade12 Early E1A protein Early E1A 29.5 kDa protein protein protein ade12 Human adenovirus A serotype 12 (HAdV-12) Human adenovirus 12 MRTEMTPLVLSYQEADDILEHLVDNFFNEVPSDDDLYVPSLYELYDLDVESAGEDNNEQAVNEFFPESLILAASEGLFLPEPPVLSPVCEPIGGECMPQLHPEDMDLLCYEMGFPCSDSEDEQDENGMAHVSASAAAAAADREREEFQLDHPELPGHNCKSCEHHRNSTGNTDLMCSLCYLRAYNMFIYSPVSDNEPEPNSTLDGDERPSPPKLGSAVPEGVIKPVPQRVTGRRRCAVESILDLIQEEEREQTVPVDLSVKRPRCN E1A protein has both transforming and trans-activating activities. Disrupts the function of host retinoblastoma protein RB1/pRb, which is a key regulator of the cell cycle. Induces the disassembly of the E2F1 transcription factors from RB1 by direct competition for the same binding site on RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Inactivation of the ability of RB1 to arrest the cell cycle is critical for cellular transformation, uncontrolled cellular growth and proliferation induced by viral infection. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. The tumorigenesis-restraining activity of E1A may be related to the disruption of the host CtBP-CtIP complex through the CtBP binding motif mint A93A93A62D4541BE hmgb1_mouse High mobility group protein B1 Hmgb1 Hmg-1 Hmg1 High mobility group protein 1 protein protein mouse Mus musculus Mouse MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE 8A868DE266D552B5 q8jsk4_ade03 Early E1A protein E1A protein protein hadv-3 Human adenovirus B serotype 3 HAdV-3 Human adenovirus 3 MRHLRFLPQEVISSETGIEILEFVVNTLMGDDPEPPVQPFDPPTLHDLYDLEIDGPEDPNEEAVNGFFTDSMLLAADEGLDINPPPETLVTPGVVVESGIGGKKLPDLGAAEMDLRCYEEGFPPSDDEDGETEQSIHTAVNEGVKAASDVFKLDCPELPGHGCKSCEFHRNNTGMKELLCSLCYMRMHCHFIYSPVSDDESPSPDSTTSPPEIQAPAPANVCKPIPVKPKPGKRPAVDKLEDLLEGGDGPLDLSTRKLPRQ mint BDBEEF2E4E7BACA4 po5f1_human POU domain, class 5, transcription factor 1 Octamer-binding transcription factor 3 Octamer-binding protein 3 POU5F1 OCT3 OCT4 OTF3 Octamer-binding protein 4 protein protein human Homo sapiens Human MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN DIP protein Q01860 original sequence version: 131 DIP protein Q01860 original sequence version: 150 DIP protein Q01860 original sequence version: 138 934C58DAEA0C535B hmgb2_mouse High mobility group protein B2 Hmgb2 Hmg2 High mobility group protein 2 protein protein mouse Mus musculus Mouse MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDLAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSENRPKIKIEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEEEEDDEEEEEDEE DIP protein P30681 original sequence version: 94 45D1F667DB4ED94D e1a-pou5f1-2 2 4 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association F1 F3 homomint mint e1a-pou5f1-3 2 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association F1 F3 homomint mint e1a-pou5f1-4 3 4 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association F2 homomint mint e1a-pou5f1-5 3 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association F2 homomint mint pou5f1-hmgb1 2 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association F4A,C homomint mint hmgb1-pou5f1 3 5 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association F4B homomint mint pou5f1-hmgb1-1 1 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association F5 homomint mint pou5f1-hmgb2 1 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association F5 mint