MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it tBID, a membrane-targeted death ligand, oligomerizes BAK to release cytochrome c. tBID, a membrane-targeted death ligand, oligomerizes BAK to release cytochrome c. Genes Dev. (0890-9369) 2000 Wei MC., Lindsten T., Mootha VK., Weiler S., Gross A., Ashiya M., Thompson CB., Korsmeyer SJ. Virus - Publications including interactions involving viral proteins no in vitro In vitro pull down pull down predetermined predetermined participant predetermined Wei MC., Lindsten T., Mootha VK., Weiler S., Gross A., Ashiya M., Thompson CB., Korsmeyer SJ. Virus - Publications including interactions involving viral proteins no Genes Dev. (0890-9369) 2000 tBID, a membrane-targeted death ligand, oligomerizes BAK to release cytochrome c. tBID, a membrane-targeted death ligand, oligomerizes BAK to release cytochrome c. Genes Dev. (0890-9369) 2000 Wei MC., Lindsten T., Mootha VK., Weiler S., Gross A., Ashiya M., Thompson CB., Korsmeyer SJ. Virus - Publications including interactions involving viral proteins no in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Wei MC., Lindsten T., Mootha VK., Weiler S., Gross A., Ashiya M., Thompson CB., Korsmeyer SJ. Virus - Publications including interactions involving viral proteins no Genes Dev. (0890-9369) 2000 bid_mouse BH3-interacting domain death agonist p22 BID Bid protein protein mouse Mus musculus Mouse MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD DIP protein P70444 original sequence version: 65 DIP protein P70444 original sequence version: 69 DIP protein P70444 original sequence version: 137 52F412714FB867F3 bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS DIP protein Q16611 original sequence version: 74 DIP protein Q16611 original sequence version: 162 DIP protein Q16611 original sequence version: 97 DIP protein Q16611 original sequence version: 158 DIP protein Q16611 original sequence version: 151 DIP protein Q16611-1 original sequence version: 178 DIP protein Q16611-1 original sequence version: 180 DIP protein Q16611 original sequence version: 121 A2200FE72A46D04E bid-bak1-2 2 3 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P15 range MINT-429869: original sequence: 1-59 : MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQT Stoichiometry: 1.0 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint mint bid-bak1-3 1 3 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P15 range MINT-429882: original sequence: 1-59 : MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQT Stoichiometry: 1.0 4 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction homomint mint