IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Transcriptional repression of the transforming growth factor β (TGF-β) Pseudoreceptor BMP and activin membrane-bound inhibitor (BAMBI) by Nuclear Factor κB (NF-κB) p50 enhances TGF-β signaling in hepatic stellate cells. Transcriptional repression of the transforming growth factor β (TGF-β) Pseudoreceptor BMP and activin membrane-bound inhibitor (BAMBI) by Nuclear Factor κB (NF-κB) p50 enhances TGF-β signaling in hepatic stellate cells. J. Biol. Chem. (0021-9258) 2014 imex curation Liu C., Chen X., Yang L., Kisseleva T., Brenner D.A., Seki E. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis IBD - Inflammatory bowel disease ekseki@ucsd.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hsc Homo sapiens hepatic stellate cell hsc hepatic stellate cell ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Liu C., Chen X., Yang L., Kisseleva T., Brenner D.A., Seki E. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis ekseki@ucsd.edu Accepted 2014-NOV-10 by ORCHARD J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation Transcriptional repression of the transforming growth factor β (TGF-β) Pseudoreceptor BMP and activin membrane-bound inhibitor (BAMBI) by Nuclear Factor κB (NF-κB) p50 enhances TGF-β signaling in hepatic stellate cells. Transcriptional repression of the transforming growth factor β (TGF-β) Pseudoreceptor BMP and activin membrane-bound inhibitor (BAMBI) by Nuclear Factor κB (NF-κB) p50 enhances TGF-β signaling in hepatic stellate cells. J. Biol. Chem. (0021-9258) 2014 imex curation Liu C., Chen X., Yang L., Kisseleva T., Brenner D.A., Seki E. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis IBD - Inflammatory bowel disease ekseki@ucsd.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-lx2 Homo sapiens hepatic stellate cell line lx-2 lx-2 human hepatic stellate cell line lx-2 ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Liu C., Chen X., Yang L., Kisseleva T., Brenner D.A., Seki E. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis The adenovirus NF-kappa-B supperrepressor (IkBsr) expression construct is described in more detail in PMID:17952090 and PMID:9466975. ekseki@ucsd.edu Accepted 2014-NOV-10 by ORCHARD J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation Transcriptional repression of the transforming growth factor β (TGF-β) Pseudoreceptor BMP and activin membrane-bound inhibitor (BAMBI) by Nuclear Factor κB (NF-κB) p50 enhances TGF-β signaling in hepatic stellate cells. Transcriptional repression of the transforming growth factor β (TGF-β) Pseudoreceptor BMP and activin membrane-bound inhibitor (BAMBI) by Nuclear Factor κB (NF-κB) p50 enhances TGF-β signaling in hepatic stellate cells. J. Biol. Chem. (0021-9258) 2014 imex curation Liu C., Chen X., Yang L., Kisseleva T., Brenner D.A., Seki E. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis IBD - Inflammatory bowel disease ekseki@ucsd.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-lx2 Homo sapiens hepatic stellate cell line lx-2 lx-2 human hepatic stellate cell line lx-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu C., Chen X., Yang L., Kisseleva T., Brenner D.A., Seki E. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis The adenovirus NF-kappa-B supperrepressor (IkBsr) expression construct is described in more detail in PMID:17952090 and PMID:9466975. ekseki@ucsd.edu Accepted 2014-NOV-10 by ORCHARD J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation p19838-pro_0000030311 Nuclear factor NF-kappa-B p50 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG 1 433 5D027BB8EBCAA33A bambi_human_gene BMP and activin membrane-bound inhibitor homolog (BAMBI) human gene gene gene human Homo sapiens Human hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 nfkb1-hdac1 3 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Fig. 4g lipopolysaccharide (LPS) (from Escherichia coli serotype 055:B5) tumor necrosis factor alpha (TNF-alpha) (recombinant human) HDAC1 did not co-immunoprecipitate with anti-p50 antibody in cells not treated with either LPS or TNF-alpha. I-kappa-B superrepressor (IkBsr) (P25963 (NF-kappa-B inhibitor alpha) with ser32ala and ser36ala mutations), a potent and specific inhibitor of NF-kappa-B activation nfkb1-bambi 2 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 3i, 3j, 4f lipopolysaccharide (LPS) (from Escherichia coli serotype 055:B5) tumor necrosis factor alpha (TNF-alpha) (recombinant human) I-kappa-B superrepressor (IkBsr) (P25963 (NF-kappa-B inhibitor alpha) with ser32ala and ser36ala mutations), a potent and specific inhibitor of NF-kappa-B activation P19838-PRO_0000030311 decreases expression at RNA level of ENSG00000095739 P25963 decreases binding of P19838-PRO_0000030311 to ENSG00000095739 trichostatin A (TSA), an inhibitor of class I and II histone deacetylase (HDAC) enzymes nfkb1-bambi-1 1 5 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait association association Fig. 3i lipopolysaccharide (LPS) (from Escherichia coli serotype 055:B5) tumor necrosis factor alpha (TNF-alpha) (recombinant human) hdac1-bambi 2 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4c, 4d, 4e lipopolysaccharide (LPS) (from Escherichia coli serotype 055:B5) tumor necrosis factor alpha (TNF-alpha) (recombinant human) trichostatin A (TSA), an inhibitor of class I and II histone deacetylase (HDAC) enzymes I-kappa-B superrepressor (IkBsr) (P25963 (NF-kappa-B inhibitor alpha) with ser32ala and ser36ala mutations), a potent and specific inhibitor of NF-kappa-B activation Q13547 decreases expression at RNA level of ENSG00000095739 P25963 decreases binding of Q13547 to ENSG00000095739 hdac1-bambi-1 1 5 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait association association Fig. 4c lipopolysaccharide (LPS) (from Escherichia coli serotype 055:B5) tumor necrosis factor alpha (TNF-alpha) (recombinant human) BAMBI promoter DNA did not co-immunoprecipitate with anti-HDAC1 antibody in cells not treated with either LPS or TNF-alpha.