IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mints, Munc18-interacting proteins in synaptic vesicle exocytosis. Mints, Munc18-interacting proteins in synaptic vesicle exocytosis. J. Biol. Chem. (0021-9258) 1997 imex curation Okamoto M., Sudhof TC. Synapse - Interactions of proteins with an established role in the presynapse. Authors also comment that a kinase related transcript and unknown protein were also detected. TSudho@Mednet.SWMED.edu 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. rat brain cDNA library (postnatal day 8) davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Okamoto M., Sudhof TC. Synapse - Interactions of proteins with an established role in the presynapse. Authors also comment that a kinase related transcript and unknown protein were also detected. TSudho@Mednet.SWMED.edu Accepted 2009-FEB-13 by DAVET. 03-Mar-2009: Contacted by JYOTI. rat brain cDNA library (postnatal day 8) J. Biol. Chem. (0021-9258) 1997 davet Only protein-protein interactions imex curation Mints, Munc18-interacting proteins in synaptic vesicle exocytosis. Mints, Munc18-interacting proteins in synaptic vesicle exocytosis. J. Biol. Chem. (0021-9258) 1997 imex curation Okamoto M., Sudhof TC. Synapse - Interactions of proteins with an established role in the presynapse. Authors also comment that a kinase related transcript and unknown protein were also detected. TSudho@Mednet.SWMED.edu 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. rat brain cDNA library (postnatal day 8) davet Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Okamoto M., Sudhof TC. Synapse - Interactions of proteins with an established role in the presynapse. Authors also comment that a kinase related transcript and unknown protein were also detected. TSudho@Mednet.SWMED.edu Accepted 2009-FEB-13 by DAVET. 03-Mar-2009: Contacted by JYOTI. rat brain cDNA library (postnatal day 8) J. Biol. Chem. (0021-9258) 1997 davet Only protein-protein interactions imex curation Mints, Munc18-interacting proteins in synaptic vesicle exocytosis. Mints, Munc18-interacting proteins in synaptic vesicle exocytosis. J. Biol. Chem. (0021-9258) 1997 imex curation Okamoto M., Sudhof TC. Synapse - Interactions of proteins with an established role in the presynapse. Authors also comment that a kinase related transcript and unknown protein were also detected. TSudho@Mednet.SWMED.edu 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. rat brain cDNA library (postnatal day 8) davet Only protein-protein interactions rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Okamoto M., Sudhof TC. Synapse - Interactions of proteins with an established role in the presynapse. Authors also comment that a kinase related transcript and unknown protein were also detected. TSudho@Mednet.SWMED.edu Accepted 2009-FEB-13 by DAVET. 03-Mar-2009: Contacted by JYOTI. rat brain cDNA library (postnatal day 8) J. Biol. Chem. (0021-9258) 1997 davet Only protein-protein interactions imex curation Mints, Munc18-interacting proteins in synaptic vesicle exocytosis. Mints, Munc18-interacting proteins in synaptic vesicle exocytosis. J. Biol. Chem. (0021-9258) 1997 imex curation Okamoto M., Sudhof TC. Synapse - Interactions of proteins with an established role in the presynapse. Authors also comment that a kinase related transcript and unknown protein were also detected. TSudho@Mednet.SWMED.edu 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. rat brain cDNA library (postnatal day 8) davet Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Okamoto M., Sudhof TC. Synapse - Interactions of proteins with an established role in the presynapse. Authors also comment that a kinase related transcript and unknown protein were also detected. TSudho@Mednet.SWMED.edu Accepted 2009-FEB-13 by DAVET. 03-Mar-2009: Contacted by JYOTI. rat brain cDNA library (postnatal day 8) J. Biol. Chem. (0021-9258) 1997 davet Only protein-protein interactions imex curation dlg4_rat Disks large homolog 4 Dlg4 Dlgh4 Postsynaptic density protein 95 Synapse-associated protein 90 Psd95 protein protein rat Rattus norvegicus (Rat) Rat MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL DIP protein P31016 original sequence version: 86 DIP protein P31016-1 original sequence version: 148 7922D4E8E0F9AD85 stx5_rat Syntaxin-5 Stx5 Stx5a protein protein rat Rattus norvegicus (Rat) Rat MIPRKRYGSKNTDQGVYLGLSKTQVLSPATAINSSSDIAPLPTPVALVPSPPDTMSCRDRTQEFLSACKSLQSRQNGIQTNKPALHATRQCSEFTLMARRIGKDLSNTFAKLEKLTILAKRKSLFDDKAVEIEELTYIIKQDINSLNKQIAQLQDFVRAKGSQSGRHLQTHSNTIVVSLQSKLASMSNDFKSVLEVRTENLKQQRNRREQFSRAPVSALPLAPNNLGGGPIVLGGESRASRDVAIDMMDPRTSQQLQLIDEQDSYIQSRADTMQNIESTIVELGSIFQQLAHMVKEQEETIQRIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFLA 0B0D0B2C261A39B4 apba1_rat Amyloid-beta A4 precursor protein-binding family A member 1 Neuron-specific X11 protein Neuronal Munc18-1-interacting protein 1 Adapter protein X11alpha Apba1 Mint1 X11 protein protein rat Rattus norvegicus (Rat) Rat MNHLEGSAEVEVADEAPGGEVNESVEADLEHPEVEEEQQPSPPPPAGHAPEDHRAHPAPPPPPPPQEEEEERGECLARSASTESGFHNHTDTAEGDVLAAARDGYEAERAQDADDESAYAVQYRPEAEEYTEQAEAEHAEAAQRRALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRAEDEPYAEPYADYGGLQEHVYEEIGDAPELEARDGLRLYERERDEAAAYRQEALGARLHHYDERSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAEQDLERAPTPGGGHPDSPGLPAPAGQQQRVVGTPGGSEVGQRYSKEKRDAISLAIKDIKEAIEEVKTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPVDGDSPSPGSSSPLGAESSITPLHPGDPTEASTNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKTAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQEPMMDHPLRTISYIADIGNIVVLMARRRMPRSNSQENVEASHPSQDAKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYNDDLIHFSKSENCKDVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQSRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPVYI 57F6EEA458376CAD apba2_rat Amyloid-beta A4 precursor protein-binding family A member 2 Apba2 Mint2 Neuron-specific X11L protein Neuronal Munc18-1-interacting protein 2 Adapter protein X11beta protein protein rat Rattus norvegicus (Rat) Rat MAHRKRQSTASSMLDHRARPGPIPHDQEPENEDTELPLESYVPTGLELGTLRPDSPTPEEQECHNHSPDGDSSSDYVNNTSEEEDYDEGLPEEEEGVTYYIRYCPEDDSYLEGMDCNGEEYLAHGAHPVDTDECQEAVEDWTDSVGPHTHSHGAENSQEYPDSHLPIPEDDPTVLEVHDQEEDGHYCPSKESYQDYYPPETNGNTGGASPYRMRRGDGDLEEQEEDIDQIVAEIKMSLSMTSITSASEASPEHMPELDPGDSTEACSPSDTGRGPSRQEARPKSLNLPPEVKHSGDPQRGLKTKTRTPEERPKWPQEQVCNGLEQPRKQQRSDLNGPTDNNNIPETKKVASFPSFVAVPGPCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKANSEGDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIETTPGAQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDIINTQEMYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILANMMNGGPAARSGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVTTVLIKRPDLKYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHEKIVQALSNSVGEIHMKTMPAAMFRLLTGQETPLYI C96842E9657169B6 stxb1_rat Syntaxin-binding protein 1 Stxbp1 Unc18a Protein unc-18 homolog 1 Protein unc-18 homolog A N-Sec1 rbSec1 p67 protein protein rat Rattus norvegicus (Rat) Rat MAPIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPTMGEGPDKARSQLLILDRGFDPSSPVLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVLLDEDDDLWIALRHKHIAEVSQEVTRSLKDFSSSKRMNTGEKTTMRDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKHYQGTVDKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRIILLYIFLKNGITEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTPIIKDIMEDTIEDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIFILGGVSLNEMRCAYEVTQANGKWEVLIGSTHILTPQKLLDTLKKLNKTDEEISS DIP protein P61765 original sequence version: 98 DIP protein P61765-1 original sequence version: 86 DIP protein P61765-1 original sequence version: 79 DIP protein P61765 original sequence version: 116 2DD0715F875CE0F3 stx1a_rat Syntaxin-1A Synaptotagmin-associated 35 kDa protein Neuron-specific antigen HPC-1 Stx1a Sap protein protein rat Rattus norvegicus (Rat) Rat MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG DIP protein P32851 original sequence version: 74 DIP protein P32851 original sequence version: 78 DIP protein P32851 original sequence version: 142 DIP protein P32851 original sequence version: 138 DIP protein P32851 original sequence version: 89 DIP protein P32851 original sequence version: 115 DIP protein P32851 original sequence version: 134 DIP protein P32851 original sequence version: 121 DIP protein P32851 original sequence version: 123 DIP protein P32851 original sequence version: 150 DIP protein P32851 original sequence version: 156 DIP protein P32851 original sequence version: 163 DIP protein P32851 original sequence version: 126 DIP protein P32851 original sequence version: 124 DIP protein P32851 original sequence version: 158 8F929F489E323CAA apba1-stxbp1 1 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait physical association physical association 1 Munc18-1-interacting domain, residues 226-314 of Mint1 as the minimal Munc18-1-interacting sequence tested munc18-mint2 1 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 1a munc18-psd95 1 5 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association munc18-syntaxin_5 1 9 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association mint1-munc18 4 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] association association 2 Analysis of the eluates by SDS-PAGE followed by Coomassie Blue staining and immunoblotting revealed that we purified Munc18-1 on both Mint columns as the major component and syntaxin 1 as a minor component Both Mint columns as the major component and syntaxin 1 as a minor component however mapping of syntaxin was not possible since the variant detected not clear from the publication. mint2-munc18-1 4 9 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association 2 Analysis of the eluates by SDS-PAGE followed by Coomassie Blue staining and immunoblotting revealed that we purified Munc18-1 on both Mint columns as the major component and syntaxin 1 as a minor component Both Mint columns as the major component and syntaxin 1 as a minor component however mapping of syntaxin was not possible since the variant detected not clear from the publication. munc18-mint1 3 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 3 Co-immunoprecipitation of Munc18-1 and syntaxin 1 with Mint proteins from rat brain homogenates. munc18-mint2-1 3 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 3 Co-immunoprecipitation of Munc18-1 and syntaxin 1 with Mint proteins from rat brain homogenates. mint1-munc18-1 2 9 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 4 Munc18-1 alone bound to Mint proteins. Syntaxin 1 bound only if Munc18-1 was also added, and SNAP-25 did not bind under any condition. mint1-munc18-2 2 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 10 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 physical association physical association 4 Munc18-1 alone bound to Mint proteins. Syntaxin 1 bound only if Munc18-1 was also added, and SNAP-25 did not bind under any condition.