IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A role for POR1, a Rac1-interacting protein, in ARF6-mediated cytoskeletal rearrangements. A role for POR1, a Rac1-interacting protein, in ARF6-mediated cytoskeletal rearrangements. EMBO J. (0261-4189) 1997 D'Souza-Schorey C., Boshans RL., McDonough M., Stahl PD., Van Aelst L. Synapse - Interactions of proteins with an established role in the presynapse. The ARF6-GST fusion protein was loaded with either GTP-gammaS or GDP-betaS (non-hydrolyzable analogs of GTP and GDP respectively). schorey@cellbio.wustl.edu yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined D'Souza-Schorey C., Boshans RL., McDonough M., Stahl PD., Van Aelst L. Synapse - Interactions of proteins with an established role in the presynapse. The ARF6-GST fusion protein was loaded with either GTP-gammaS or GDP-betaS (non-hydrolyzable analogs of GTP and GDP respectively). Fig. 6 schorey@cellbio.wustl.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. EMBO J. (0261-4189) 1997 A role for POR1, a Rac1-interacting protein, in ARF6-mediated cytoskeletal rearrangements. A role for POR1, a Rac1-interacting protein, in ARF6-mediated cytoskeletal rearrangements. EMBO J. (0261-4189) 1997 D'Souza-Schorey C., Boshans RL., McDonough M., Stahl PD., Van Aelst L. Synapse - Interactions of proteins with an established role in the presynapse. The ARF6-GST fusion protein was loaded with either GTP-gammaS or GDP-betaS (non-hydrolyzable analogs of GTP and GDP respectively). schorey@cellbio.wustl.edu in vitro In vitro pull down pull down polyclonal western polyclonal antibody western blot polyclonal western D'Souza-Schorey C., Boshans RL., McDonough M., Stahl PD., Van Aelst L. Synapse - Interactions of proteins with an established role in the presynapse. The ARF6-GST fusion protein was loaded with either GTP-gammaS or GDP-betaS (non-hydrolyzable analogs of GTP and GDP respectively). schorey@cellbio.wustl.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. Annotation to indicate that this entry has been checked and accepted by a senior curator. EMBO J. (0261-4189) 1997 A role for POR1, a Rac1-interacting protein, in ARF6-mediated cytoskeletal rearrangements. A role for POR1, a Rac1-interacting protein, in ARF6-mediated cytoskeletal rearrangements. EMBO J. (0261-4189) 1997 D'Souza-Schorey C., Boshans RL., McDonough M., Stahl PD., Van Aelst L. Synapse - Interactions of proteins with an established role in the presynapse. The ARF6-GST fusion protein was loaded with either GTP-gammaS or GDP-betaS (non-hydrolyzable analogs of GTP and GDP respectively). schorey@cellbio.wustl.edu yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast beta galactosidase beta galactosidase complementation beta galactosidase predetermined predetermined participant predetermined D'Souza-Schorey C., Boshans RL., McDonough M., Stahl PD., Van Aelst L. Synapse - Interactions of proteins with an established role in the presynapse. The ARF6-GST fusion protein was loaded with either GTP-gammaS or GDP-betaS (non-hydrolyzable analogs of GTP and GDP respectively). schorey@cellbio.wustl.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. EMBO J. (0261-4189) 1997 rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL ACEDF83A45E5EA67 arfp2_human Arfaptin-2 ADP-ribosylation factor-interacting protein 2 Partner of RAC1 ARFIP2 POR1 protein protein human Homo sapiens Human MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ AB8D224430D8E213 arf3_human ADP-ribosylation factor 3 ARF3 protein protein human Homo sapiens Human MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK D6FA234DFAED3E5F arf6_human ADP-ribosylation factor 6 ARF6 protein protein human Homo sapiens Human MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS DIP protein P62330 original sequence version: 126 DIP protein P62330 original sequence version: 113 DIP protein P62330 original sequence version: 105 49E38E59AEA52B98 arf6-arfip2-1 2 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey mbp-tag region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association POR1 (P53365) bound preferentially to the GTP-bound form of ARF6 (P62330). arf6-arfip2-2 1 7 unspecified role unspecified role bait bait P62330:p.Thr28Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T N Wed May 02 15:50:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr28asn' Tue Jun 30 17:46:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr28Asn' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rac1-arfip2-1 1 4 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association arfip2-arf6-3 1 5 unspecified role unspecified role bait bait c-terminal binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-640623]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 912-912, sequence length 341 [EBI-640623]208-912 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ARF6 also contains a gln67leu mutation which results in it being GTPase-defective. However this does not appear to effect binding to POR1. arf3-arfip2-1 1 5 unspecified role unspecified role bait bait c-terminal binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-640722]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 912-912, sequence length 341 [EBI-640722]208-912 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ARF3 also contained the mutation gln71leu, which resulted in it being GTP-defective. rac1-arfip2 3 5 unspecified role unspecified role prey prey c-terminal binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-641560]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 912-912, sequence length 341 [EBI-641560]208-912 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association The strength of this interaction was measured at 75 +/- 1.1 Miller units. Rac1 possessed a gly12val mutation, producing an activation mutant. arf6-arfip2-3 3 7 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role prey prey c-terminal binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-641584]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 912-912, sequence length 341 [EBI-641584]208-912 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association The strength of this interaction was measured at 71 +/- 1.5 Miller units. Arf6 possessed a gln67leu mutation, producing a mutant defective in GTPase activity.