IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. Mol. Biol. Cell (1059-1524) 2009 imex curation Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. 23-Feb-2010: Contacted by JYOTI. orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. cosedimentation cosedimentation western blot western blot Immuno blot Immuno blot Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. Accepted 2010-FEB-12 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Mol. Biol. Cell (1059-1524) 2009 orchard Only protein-protein interactions imex curation SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. Mol. Biol. Cell (1059-1524) 2009 imex curation Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. 23-Feb-2010: Contacted by JYOTI. orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. Accepted 2010-FEB-12 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Mol. Biol. Cell (1059-1524) 2009 orchard Only protein-protein interactions imex curation SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. Mol. Biol. Cell (1059-1524) 2009 imex curation Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. 23-Feb-2010: Contacted by JYOTI. orchard Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy tag visualisation tag visualisation Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. HA tagged proteins were visualised by immunostaining. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. Accepted 2010-FEB-12 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Mol. Biol. Cell (1059-1524) 2009 orchard Only protein-protein interactions imex curation SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. Mol. Biol. Cell (1059-1524) 2009 imex curation Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. 23-Feb-2010: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. Accepted 2010-FEB-12 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Mol. Biol. Cell (1059-1524) 2009 orchard Only protein-protein interactions imex curation SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. Mol. Biol. Cell (1059-1524) 2009 imex curation Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. 23-Feb-2010: Contacted by JYOTI. orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. The main body of the paper states that this co-ip was carried out in HEK293 cells, whereas the figure legend states they were obtained in HEK293T cells. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. Accepted 2010-FEB-12 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Mol. Biol. Cell (1059-1524) 2009 orchard Only protein-protein interactions imex curation SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. Mol. Biol. Cell (1059-1524) 2009 imex curation Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. 23-Feb-2010: Contacted by JYOTI. orchard Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. Jyoti -May 6th - have re-named this interaction as zhu-2009-9 (rather than zhu-2009-3 duplicate) - I cannot see another IP in HeLa cells in the paper (Fig 4A) - I think you will have to mark this as "accepted" - as I cannot... have deleted the second "journal entry" in the hope I could re-add Curation Depth - "imex curation" - but Curation Depth still is not visible on the drop-down-menu. cant get rid of 2 "journals" as Bottom TOPIC - have emailed Bruno... I is needed as Imex Curation - not journal = cannot find "curation Depth" on drop-down menu. Cells used were from A-5RT3(CTRL) and A-5RT3 (ANGPTL4) tumour biopsies. The former line contains a stably integrated non-targeting scrambled siRNA, as a control line, and the A-5RT3 (ANGPTL4) line contains an siRNA targeting a segment of the ANGPTL4 sequence. As a result mRNA and protein levels of ANGPTL4 were suppressed by >85% in the A-5RT3 (ANGPTL4) cell line, as compared to the control line. The authors confirm that integrins beta-1 and beta 5 were of human origin. Details of ANGPTL4 were obtained from Goh et al.,JBC 285, 2010. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. Accepted 2010-FEB-12 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Mol. Biol. Cell (1059-1524) 2009 orchard Only protein-protein interactions imex curation SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. Mol. Biol. Cell (1059-1524) 2009 imex curation Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. 23-Feb-2010: Contacted by JYOTI. orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. Accepted 2010-FEB-12 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Mol. Biol. Cell (1059-1524) 2009 orchard Only protein-protein interactions imex curation SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. Mol. Biol. Cell (1059-1524) 2009 imex curation Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. 23-Feb-2010: Contacted by JYOTI. orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. Accepted 2010-FEB-12 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Mol. Biol. Cell (1059-1524) 2009 orchard Only protein-protein interactions imex curation vps16_mouse Vacuolar protein sorting-associated protein 16 homolog Vps16 protein protein mouse Mus musculus Mouse MDCYTANWNPLGDSAFYRKYELYSMDWDLKEELKDCLVAAAPYGGPIALLRNCWRKEKAASVRPVLEIYSASGLPLASLLWKSGPVVALGWSAEEELLCVQEDGAVLVYGLHGDFRRHFSMGNEVLQNRVLDARIFHTEFGSGVAILTGAYRFTLSANVGDLKLRRMPEVPGLQSAPSCWTTLCHDRVPHILLAVGPDLYLLDHATCSAVTPAGLAPGVSSFLQMAVSFTYRYLALFTDTGYIWMGTASLKEKLCEFNCNIRAPPKQMVWCSRPRSKERAVVVAWERRLMVVGNAPESIQFVLDEDSYLVPELDGVRIFSRSTHEFLHEVPVASEEIFKIASMAPGALLLEAQKEYEKESQKADEYLREIQELGQLIQAVQQCIEAAGHEHQPDMQKSLLRAASFGKCFLDRFPPDSFVHMCQDLRVLNAIRDYHIGIPLTYTQYKQLTIQVLLDRLVLRRLYPLAIQICEYLRLPEVQGVSRILAHWACYKARAWDMRDEDVARAINQKLGDTPGVSYSDIAARAYGCGRTELAIKLLEYEPRSGEQVPLLLKMKRSKLALSKAIESGDTDLVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELDTLKDLYNQDDNHQELGSFHIRASYAAEERIEGRVAALQTAADAFYKAKNEFAAKATEDQMRLLRIQRRLEDELGGRFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKHEAKKYASRVGPEQKVKALLLVGDVAQAAEVAIEHRNETELSLVLSHCTGATDGAIADKIQRARAQAQKK 42C9B3C87E5763C2 vps18_mouse Vacuolar protein sorting-associated protein 18 homolog Vps18 protein protein mouse Mus musculus Mouse MASILDEYEDSLSRSAVLQTGCPSVGIPHSGYVSAHLEKEVPIFTKQRVDFTPSERITSLVVSCNQLCMSLGKDTLLRIDLGKASEPNRVELGRKDDAKVHKMFLDHTGSHLLVALSSTEVLYMNRNGQKARPLARWKGQLVESVGWNKAMGNESSTGPILVGTAQGQIFEAELSASEGGLFGPAPDLYFRPLYVLNEEGGPAPVCSLEAERGPDGRGFVIATTRQRLFQFIGRAVEDTEAQGFAGLFAAYTDHPPPFREFPSNLGYSELAFYTPKLRSAPRAFAWMMGDGVLYGSLDCGRPDSLLSEERVWEYPAGVGPGANPPLAIVLTQFHFLLLLADRVEAVCTLTGQVVLRDHFLEKFGPLRHMVKDSSTGHLWAYTERAVFRYHVQREARDVWRTYLDMNRFDLAKEYCRERPDCLDTVLAREADFCFRQHRYLESARCYALTQSYFEEIALKFLEARQEEALAEFLQRKLAGLKPTERTQATLLTTWLTELYLSRLGALQGDPDALTLYRDTRECFRTFLSSPRHKEWLFASRASIHELLASHGDTEHMVYFAVIMQDYERVVAYHCQHEAYEEALAVLARHRDPQLFYKFSPILIRHIPRQLVDAWIEMGSRLDARQLIPALVNYSQGGEAQQVSQAIRYMEFCVNVLGETEQAIHNYLLSLYARGQPASLLAYLEQAGASPHRVHYDLKYALRLCAEHGHHRACVHVYKVLELYEEAVDLALQVDVDLAKQCADLPEEDEELRKKLWLKIARHVVQEEEDVQTAMACLASCPLLKIEDVLPFFPDFVTIDHFKEAICSSLKAYNHHIQELQREMEEATASAQRIRRDLQELRGRYGTVEPQDKCSTCDFPLLNRPFYLFLCGHMFHADCLLQAVRPGLPAYKQARLEELQRKLGAAPPPTKGSVKAKEAEAGAAAVGPSREQLKADLDELVAAECVYCGELMIRSIDRPFIDPQRYEEEHLSWL 6B4E90FC39DC897F vp33b_caeel Vacuolar protein sorting-associated protein 33B C56C10.1 vps-33.2 protein protein caeel Caenorhabditis elegans MAPGTAELEIDETLHLLRMVMQREFIHYLETLPGTKELFIDKCLLRPLDMIATSSDMKRHGVKRIMHFDLQKSPQVWNIEIDQRVFFLRPNVENARKIVEYVEESSENRSICVIWCNRQLEECDLAFESSGVIGHITQLSLNMCLLPLESDLFSLQHVESAQPDLFSVANMFVALQNLYGVIPTVYGLGSESKNLWNLVHALCSSNELRARPDQPISHLFLFDRQLDPVPVLLTGASYEGLLHEFFTIDCGKLAFPVDLRKQVQTGPLDFDWIEINPEEDKEAHQQNRGDTVKLDNCEDIFASIRNKHVTAALEFLHSKAKSIQKSIEKSSMIDDVADYRNFVEKDLRALKKDHKHCELHINACEMMMNKVKMEDYRTMFKLEHEMLLGTVTHEEYFDFVFERVPMRSCRDVVLSMMSLASLKLDGVPDDTYNEFVEMYLQKYGYEHMFELQNLRNSRVIYARRHIAHDRTISERARTWETLARKFRIVKGNEPMDMSNPSDMSYVFGARISPLLCKIVEDTIDHGWNQAEYERIIGKDKVLVEENTYIAADRRPDNRTRKAIMVFVNGGITYWEVAALRLLAIQKNFRILICTTHVIKKREYLEVRAKDASSVFGS 43F189C051F363D8 vps11_mouse Vacuolar protein sorting-associated protein 11 homolog Vps11 protein protein mouse Mus musculus Mouse MAAYLQWRRFVFFEKELVKEPLGNDGAAPGAAPVSGSAASKFLCLPPGITVCDSGRGSLVFGDMEGQIWFLPRSLQLTGFQAYKLRVTHLYQLKQHNILASVGEDEEGINPLVKIWNLEKRDGGNPLCTRIFPAIPGTEPTVVSCLTVHENLNFMAIGFTDGSVTLNKGDITRDRHSKTQILHKGNYPVTGLAFRQAGKTTHLFVVTTENVQSYIVSGKDYPRVELDTHGCGLRCSALSDPSQDLQFIVAGDECVYLYQPDERGPCFAFEGHKLIVHWFRGYLVIVSRDRKVSPKSEFTSRDSQNSDKQILNIYDLCNKFIAYSAGFEDIVDVLAEWGSLYVLTRDGRVHALQEKDTQTKLEMLFKKNLFEMAINLAKSQHLDSDGLAQIFMQYGDHLYSKGNHDGAVQQYIRTIGKLEPSYVIRKFLDAQRIHNLTAYLQTLHRQSLANADHTTLLLNCYTKLKDSSKLEEFIKTKSESEVHFDVETAIKVLRQAGYYSHALYLAENHAHHEWYLKIQLEDIKNYQEALRYIGKLPFEQAESNMKRYGKTLMHHIPEQTTQLLKGLCTDYRPSLEGRGDREALSCRASSEEFIPIFANNPRELKAFLEHMSEVQPDSPQGIYDTLLELRLQNWAHEKDPQAKEKLHAEAISLLKSGRFCDVFDKALVLCQMHDFQDGVLYLYEQGKLFQQIMHYHMQHEQYRQVIAVCERHGEQEPSLWEQALSYFARKEEDCKEYVAAVLRHIENKSLMPPLLVVQTLAHNSTATLSIIRDYLVQKLQKQSQQIAQDELRVRRYREETTRIRQEIQELKASPKIFQKTKCSICNSALELPSVHFLCGHSFHQHCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHDQFQHQLKCSNDSFSVIADYFGRGVFNKLTLLTDPPTARLTPSLEAGLQRDLLMHSRRGT DB96F07E92C9E534 vp33a_caeel Vacuolar protein sorting-associated protein 33A vps-33.1 B0303.9 slp-1 Protein slp-1 protein protein caeel Caenorhabditis elegans MAANEDRDDAAAILNWEGTSEIKSANEYSRNLLFSVLDSLDGNKTIVWDRDRSVMHRVNLFAGASVLAAHGVVANHSIETKKSASTPHVVFFLAPTMVSLDLLCDYIDNVRNDSKILYQVFFIPEAWFVVRESLKTRAEGKYWERLESVKEIPLCWLPRDGECLSLSSPQIAARLLINGDWTHLHKCAVALNQLIDMCRGRSSSSNQRPMSIYAKGKWASDVAKMMGKIRNSAEADSMTKNLDPIEGLLKINRIVLIDRWMDPLTPMLSQLTFYGLLDEIYGIGMVNSVKVPEMEFKNEKDGDPFQEKEVYLIDEVYHRLKHSHINAVSIEASKVLAEIRDDEQFDRDKMSVAEYSVLVKKMPKIINRKKMIEVHMRLAEMIQSHVYCKQSDSIKLERDLLEYSDSDKAIPLIEDLIFDASPLNAVLRLISVHSLTCGGLKPSVLQHYRRIVNQSYGSSALNKVLKMQKMGLIREKGGGGKMQCEYAQMMFQQMKKNHDMLPEEFSEAKLDDMAYAYSGFSPLLCKMLEEGDRVKWVGWPKTVIGDKSDLIAERDGRGTCVFVIGGLTRSELAIIRENLPNVALITTSALITGDKLLNNITNI FF959FE7A617BD6A vp33b_human Vacuolar protein sorting-associated protein 33B VPS33B protein protein human Homo sapiens Human MAFPHRPDAPELPDFSMLKRLARDQLIYLLEQLPGKKDLFIEADLMSPLDRIANVSILKQHEVDKLYKVENKPALSSNEQLCFLVRPRIKNMRYIASLVNADKLAGRTRKYKVIFSPQKFYACEMVLEEEGIYGDVSCDEWAFSLLPLDVDLLSMELPEFFRDYFLEGDQRWINTVAQALHLLSTLYGPFPNCYGIGRCAKMAYELWRNLEEEEDGETKGRRPEIGHIFLLDRDVDFVTALCSQVVYEGLVDDTFRIKCGSVDFGPEVTSSDKSLKVLLNAEDKVFNEIRNEHFSNVFGFLSQKARNLQAQYDRRRGMDIKQMKNFVSQELKGLKQEHRLLSLHIGACESIMKKKTKQDFQELIKTEHALLEGFNIRESTSYIEEHIDRQVSPIESLRLMCLLSITENGLIPKDYRSLKTQYLQSYGPEHLLTFSNLRRAGLLTEQAPGDTLTAVESKVSKLVTDKAAGKITDAFSSLAKRSNFRAISKKLNLIPRVDGEYDLKVPRDMAYVFGGAYVPLSCRIIEQVLERRSWQGLDEVVRLLNCSDFAFTDMTKEDKASSESLRLILVVFLGGCTFSEISALRFLGREKGYRFIFLTTAVTNSARLMEAMSEVKA BD7DB97E1FEB1D32 spe39_human Spermatogenesis-defective protein 39 homolog VIPAS39 C14orf133 SPE39 VIPAR VPS33B-interacting protein in apical-basolateral polarity regulator VPS33B-interacting protein in polarity and apical restriction protein protein human Homo sapiens Human MNRTKGDEEEYWNSSKFKAFTFDDEDDELSQLKESKRAVNSLRDFVDDDDDDDLERVSWSGEPVGSISWSIRETAGNSGSTHEGREQLKSRNSFSSYAQLPKPTSTYSLSSFFRGRTRPGSFQSLSDALSDTPAKSYAPELGRPKGEYRDYSNDWSPSDTVRRLRKGKVCSLERFRSLQDKLQLLEEAVSMHDGNVITAVLIFLKRTLSKEILFRELEVRQVALRHLIHFLKEIGDQKLLLDLFRFLDRTEELALSHYREHLNIQDPDKRKEFLKTCVGLPFSAEDSAHIQDHYTLLERQIIIEANDRHLESAGQTEIFRKHPRKASILNMPLVTTLFYSCFYHYTEAEGTFSSPVNLKKTFKIPDKQYVLTALAARAKLRAWNDVDALFTTKNWLGYTKKRAPIGFHRVVEILHKNNAPVQILQEYVNLVEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKIDALLSSSQIRWKN CF05C38EB922D192 vp33a_human Vacuolar protein sorting-associated protein 33A VPS33A protein protein human Homo sapiens Human MAAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQPGENRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPF 12442A1D9A223F56 vps39_mouse Vam6/Vps39-like protein Vps39 Pldn Vam6 protein protein mouse Mus musculus Mouse MHDAFEPVPILEKLPLQIDCLAAWEEWLLVGTKQGHLLLYRIRKDVVPADVASPESGSCNRFEVTLEKSNKNFSKKIQQIHVVSQFKILVSLLENNIYVHDLLTFQQITTVSKAKGASLFTCDLQHTETGEEVLRMCVAVRKKLQLYFWKDREFHELQGDFSVPDVPKSMAWCENSICVGFKRDYYLIRVDGKGSIKELFPTGKQLEPLVAPLADGKVAVGQDDLTVVLNEEGICTQKCALNWTDIPVAMEHQPPYIVAVLPRYVEIRTLEPRLLVQSIELQRPRFITSGGSNIIYVASNHFVWRLIPVPMATQIQQLLQDKQFELALQLAEMKDDSDSEKQQQIHHIKNLYAFNLFCQKRFDESMQVFAKLGTDPTHVMGLYPDLLPTDYRKQLQYPNPLPTLSGAELEKAHLALIDYLTQKRSQLVKKLNDSDHQSSTSPLMEGTPTIKSKKKLLQIIDTTLLKCYLHTNVALVAPLLRLENNHCHIEESEHVLKKAHKYSELIILYEKKGLHEKALQVLVDQSKKANSPLKGHERTVQYLQHLGTENLHLIFSYSVWVLRDFPEDGLKIFTEDLPEVESLPRDRVLNFLIENFKALAIPYLEHIIHVWEETGSQFHNCLIQLYCEKVQSLMKDYLLSLPTGKSPVPAGEEGGELGEYRQKLLMFLEISSHYDPGRLICDFPFDGLLEERALLLGRMGKHEQALFIYVHVLKDTKMAKEYCHKHYDQNKEGNKDVYLSLLRMYLSPPSIHCLGPIKLELLEPQANLQAALQVLELHYSKLDTTKAINLLPANTQINDIRIFLEKVLEENAQKKRFNQVLKNLLHAEFLRVQEERILHQQVKCIITEEKVCMVCKKKIGNSAFARYPNGVVVHYFCSKEVNSADT BD46EF52D404C2DA spe39_caeel Spermatogenesis-defective protein 39 vipar spe-39 ZC404.3 VPS33B-interacting protein in polarity and apical restriction protein protein caeel Caenorhabditis elegans MALRRKFTFELPEDSYWNESDSNSSGLFDDLQSKQLQARAAVDNLFGGDETPKPYVRPQNPTPTPTNVPLQIDGRAAAVSDKANIRITDTSPRASGKIVDDFLNMKFAENVNVAPVIQTAPSVVSEASASSLPSEAQRLDLDYNRLRQEHRKLKDQHEVLRHERFQPLTIEASIKRMLQGHTVTLDYYRSLRDKTQLLKQAVATYDNNTIFKIVIFLERTLKENIFCKIMDGQKSACRVYTRHLQITGEWDKMNKFLRSIGQYQHASVIEFEATRKYKRNPDKRVPLLRTMLHGSFSIPEMKFEARQMEALMRNYEIQLQMEKMDAGDKGEHFRKFPKTSSLIGLPALSSLYYSAMYHYDDSPTSAASLPSVQTLIRFNDRLATQTIVSALTRLSRWPDIDKLLQPKTITMTFSAAKSVFKGKKSTSKWGVSINNHNLLTIVKRSHPSPPTDFIYRILKGESDAQERLRLALLFDVPEMVIECLTQKGDRLSLASYAKSLKTNSVESFKAVAALNNPSIKWK 16816064C7345E55 vps41_human Vacuolar protein sorting-associated protein 41 homolog VPS41 S53 protein protein human Homo sapiens Human MAEAEEQETGSLEESTDESEEEESEEEPKLKYERLSNGVTEILQKDAASCMTVHDKFLALGTHYGKVYLLDVQGNITQKFDVSPVKINQISLDESGEHMGVCSEDGKVQVFGLYSGEEFHETFDCPIKIIAVHPHFVRSSCKQFVTGGKKLLLFERSWMNRWKSAVLHEGEGNIRSVKWRGHLIAWANNMGVKIFDIISKQRITNVPRDDISLRPDMYPCSLCWKDNVTLIIGWGTSVKVCSVKERHASEMRDLPSRYVEIVSQFETEFYISGLAPLCDQLVVLSYVKEISEKTEREYCARPRLDIIQPLSETCEEISSDALTVRGFQENECRDYHLEYSEGESLFYIVSPRDVVVAKERDQDDHIDWLLEKKKYEEALMAAEISQKNIKRHKILDIGLAYINHLVERGDYDIAARKCQKILGKNAALWEYEVYKFKEIGQLKAISPYLPRGDPVLKPLIYEMILHEFLESDYEGFATLIREWPGDLYNNSVIVQAVRDHLKKDSQNKTLLKTLAELYTYDKNYGNALEIYLTLRHKDVFQLIHKHNLFSSIKDKIVLLMDFDSEKAVDMLLDNEDKISIKKVVEELEDRPELQHVYLHKLFKRDHHKGQRYHEKQISLYAEYDRPNLLPFLRDSTHCPLEKALEICQQRNFVEETVYLLSRMGNSRSALKMIMEELHDVDKAIEFAKEQDDGELWEDLILYSIDKPPFITGLLNNIGTHVDPILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLREGCKKILVADSLSLLKKMHRTQMKGVLVDEENICESCLSPILPSDAAKPFSVVVFHCRHMFHKECLPMPSMNSAAQFCNICSAKNRGPGSAILEMKK 037577D5FA3A18A0 spe-39-slp-1 4 13 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 18 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Fig 2. vps33b-c14orf133 6 15 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association Fig 4A. Endogenous hSPE-39 bound to the anti-hSPE-39 mAb 64-8A12 coimmunoprecipitates endogenous hVPS33B in HeLa cells vps33a-c14orf133-1 8 16 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 4B. Immunoprecipitation with anti-hSPE-39 antibody resulted in coimmunoprecipitation of both hVPS33A-HA and hSPE-39-EGFP from the cell lysate. vps33b-c14orf133-2 3 14 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 4 C-J. vps33b-c14orf133-1 5 15 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey physical association physical association Supplemental Fig 3. vps-c14orf133 1 9 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 5. c14orf133-vps41 2 14 unspecified role unspecified role prey prey 19 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6A. c14orf133-vps11-1 7 14 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6B. c14orf133-vps11-2 2 15 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary fig 4A. c14orf133-vps18-2 7 15 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Fig 4B. spe-39-vps-33-2 4 11 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 18 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Fig 2. vps33a-c14orf133 3 16 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 4 C-J. Again, could find no clear info regarding N/C terminal nature of tags. The two VP proteins are recombinant in origin - but I could not see/remember how to enter this, so I have entered as "Expressed-in" -presumably meaning 'over-expressed' in this context. ?OK. something should be added here, I think... c14orf133-vps16 2 9 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey association association Fig 6A. c14orf133-vps18 2 15 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6A. c14orf133-vps39 2 15 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey association association Fig 6A. c14orf133-vps11 2 14 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6A. c14orf133-vps16-2 2 9 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary fig 4A. c14orf133-vps18-3 2 15 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary fig 4A. c14orf133-vps41-2 2 15 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary fig 4A. c14orf133-vps16-1 7 15 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey association association Fig 6B. c14orf133-vps18-1 7 15 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6B. c13orf133-vps41 7 14 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6B. c14orf133-vps41-1 7 15 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Fig 4B.