IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Septins regulate actin organization and cell-cycle arrest through nuclear accumulation of NCK mediated by SOCS7. Septins regulate actin organization and cell-cycle arrest through nuclear accumulation of NCK mediated by SOCS7. Cell (0092-8674) 2007 imex curation Kremer BE., Adang LA., Macara IG. Synapse - Interactions of proteins with an established role in the presynapse. Data from Supp. Fig. 3 not added as anti-NCK AB recognises both NCK1 and NCK2 igm9c@virginia.edu 13-Nov-2007: Contacted by JYOTI. davet Only protein-protein interactions 5 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kremer BE., Adang LA., Macara IG. Synapse - Interactions of proteins with an established role in the presynapse. This experiment relates to a negative interaction. Data from Supp. Fig. 3 not added as anti-NCK AB recognises both NCK1 and NCK2 igm9c@virginia.edu Accepted 2007-NOV-18 by DAVET. 13-Nov-2007: Contacted by JYOTI. Cell (0092-8674) 2007 davet Only protein-protein interactions 5 imex curation sept6_human Septin-6 SEPTIN6 KIAA0128 SEP2 SEPT6 protein protein human Homo sapiens Human MAATDIARQVGEGCRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVLHTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTKFKIKITSELVSNGVQIYQFPTDDESVAEINGTMNAHLPFAVIGSTEELKIGNKMMRARQYPWGTVQVENEAHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRVKEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEDKKKSLDDEVNAFKQRKTAAELLQSQGSQAGGSQTLKRDKEKKNNPWLCTE DIP protein Q14141 original sequence version: 120 DIP protein Q14141 original sequence version: 152 DIP protein Q14141 original sequence version: 128 E684AE6A93B32362 o14512-2 Suppressor of cytokine signaling 7 SOCS7 NAP4 SOCS6 Nck, Ash and phospholipase C gamma-binding protein Nck-associated protein 4 protein protein human Homo sapiens Human MGGSAGRELDAGRKPKLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTSPHPPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAFPRIAPIRAAESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVEPST C0D465C715B14D11 sept6-socs7-3 1 2 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association true Septins interact with longer-variant SOCS7, but not with the splice variant NAP4. Fig. 4B