IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Human endothelial cell septins: SEPT11 is an interaction partner of SEPT5. Human endothelial cell septins: SEPT11 is an interaction partner of SEPT5. J. Pathol. (0022-3417) 2006 imex curation Blaser S., Roseler S., Rempp H., Bartsch I., Bauer H., Lieber M., Lessmann E., Weingarten L., Busse A., Huber M., Zieger B. Synapse - Interactions of proteins with an established role in the presynapse. SEPT5 was coupled to CNBr-activated Sepharose 4B. zieger@kikli.ukl.uni-freiburg.de 21-JUL-2006: Contacted by JYOTI Human brain cDNA library. Human adult heart cDNA library. Human fetal brain cDNA library. Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Blaser S., Roseler S., Rempp H., Bartsch I., Bauer H., Lieber M., Lessmann E., Weingarten L., Busse A., Huber M., Zieger B. Synapse - Interactions of proteins with an established role in the presynapse. SEPT5 was coupled to CNBr-activated Sepharose 4B. zieger@kikli.ukl.uni-freiburg.de Accepted 2006-JUL-5 by ORCHARD. 21-JUL-2006: Contacted by JYOTI Human brain cDNA library. Human adult heart cDNA library. Human fetal brain cDNA library. J. Pathol. (0022-3417) 2006 Only protein-protein interactions imex curation Human endothelial cell septins: SEPT11 is an interaction partner of SEPT5. Human endothelial cell septins: SEPT11 is an interaction partner of SEPT5. J. Pathol. (0022-3417) 2006 imex curation Blaser S., Roseler S., Rempp H., Bartsch I., Bauer H., Lieber M., Lessmann E., Weingarten L., Busse A., Huber M., Zieger B. Synapse - Interactions of proteins with an established role in the presynapse. SEPT5 was coupled to CNBr-activated Sepharose 4B. zieger@kikli.ukl.uni-freiburg.de 21-JUL-2006: Contacted by JYOTI Human brain cDNA library. Human adult heart cDNA library. Human fetal brain cDNA library. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Blaser S., Roseler S., Rempp H., Bartsch I., Bauer H., Lieber M., Lessmann E., Weingarten L., Busse A., Huber M., Zieger B. Synapse - Interactions of proteins with an established role in the presynapse. The positive controls p53 and SV40 were not adequately identified in the report so are omitted. SEPT5 was coupled to CNBr-activated Sepharose 4B. zieger@kikli.ukl.uni-freiburg.de Accepted 2006-JUL-5 by ORCHARD. 21-JUL-2006: Contacted by JYOTI Human brain cDNA library. Human adult heart cDNA library. Human fetal brain cDNA library. J. Pathol. (0022-3417) 2006 Only protein-protein interactions imex curation Human endothelial cell septins: SEPT11 is an interaction partner of SEPT5. Human endothelial cell septins: SEPT11 is an interaction partner of SEPT5. J. Pathol. (0022-3417) 2006 imex curation Blaser S., Roseler S., Rempp H., Bartsch I., Bauer H., Lieber M., Lessmann E., Weingarten L., Busse A., Huber M., Zieger B. Synapse - Interactions of proteins with an established role in the presynapse. SEPT5 was coupled to CNBr-activated Sepharose 4B. zieger@kikli.ukl.uni-freiburg.de 21-JUL-2006: Contacted by JYOTI Human brain cDNA library. Human adult heart cDNA library. Human fetal brain cDNA library. Only protein-protein interactions in vitro In vitro affinity techniques affinity technology affinity techniques western blot western blot Immuno blot Immuno blot Blaser S., Roseler S., Rempp H., Bartsch I., Bauer H., Lieber M., Lessmann E., Weingarten L., Busse A., Huber M., Zieger B. Synapse - Interactions of proteins with an established role in the presynapse. SEPT5 was coupled to CNBr-activated Sepharose 4B. zieger@kikli.ukl.uni-freiburg.de Accepted 2006-JUL-5 by ORCHARD. 21-JUL-2006: Contacted by JYOTI Human brain cDNA library. Human adult heart cDNA library. Human fetal brain cDNA library. J. Pathol. (0022-3417) 2006 Only protein-protein interactions imex curation Human endothelial cell septins: SEPT11 is an interaction partner of SEPT5. Human endothelial cell septins: SEPT11 is an interaction partner of SEPT5. J. Pathol. (0022-3417) 2006 imex curation Blaser S., Roseler S., Rempp H., Bartsch I., Bauer H., Lieber M., Lessmann E., Weingarten L., Busse A., Huber M., Zieger B. Synapse - Interactions of proteins with an established role in the presynapse. SEPT5 was coupled to CNBr-activated Sepharose 4B. zieger@kikli.ukl.uni-freiburg.de 21-JUL-2006: Contacted by JYOTI Human brain cDNA library. Human adult heart cDNA library. Human fetal brain cDNA library. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Blaser S., Roseler S., Rempp H., Bartsch I., Bauer H., Lieber M., Lessmann E., Weingarten L., Busse A., Huber M., Zieger B. Synapse - Interactions of proteins with an established role in the presynapse. SEPT5 was coupled to CNBr-activated Sepharose 4B. zieger@kikli.ukl.uni-freiburg.de Accepted 2006-JUL-5 by ORCHARD. 21-JUL-2006: Contacted by JYOTI Human brain cDNA library. Human adult heart cDNA library. Human fetal brain cDNA library. J. Pathol. (0022-3417) 2006 Only protein-protein interactions imex curation sep11_human Septin-11 SEPTIN11 SEPT11 protein protein human Homo sapiens Human MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGNKMAKARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVNNFQKKKAAAQLLQSQAQQSGAQQTKKDKDKKNASFT D467F1F315FFD028 D467F1F315FFD028 sept5_human Septin-5 SEPTIN5 Cell division control-related protein 1 PNUTL1 Peanut-like protein 1 SEPT5 protein protein human Homo sapiens Human MSTGLRYKSKLATPEDKQDIDKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLSAEERISQTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNTECWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKLKERIREEIDKFGIHVYQFPECDSDEDEDFKQQDRELKESAPFAVIGSNTVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQDSRMESPIPILPLPTPDAETEKLIRMKDEELRRMQEMLQRMKQQMQDQ 47054765DEA10D33 47054765DEA10D33 sept8_human Septin-8 SEPTIN8 KIAA0202 SEPT8 protein protein human Homo sapiens Human MAATDLERFSNAEPEPRSLSLGGHVGFDSLPDQLVSKSVTQGFSFNILCVGETGIGKSTLMNTLFNTTFETEEASHHEACVRLRPQTYDLQESNVQLKLTIVDAVGFGDQINKDESYRPIVDYIDAQFENYLQEELKIRRSLFDYHDTRIHVCLYFITPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHKFKIKIMGELVSNGVQIYQFPTDDEAVAEINAVMNAHLPFAVVGSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVNKVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQPLRKDKDKKNRSDIGAHQPGMSLSSSKVMMTKASVEPLNCSSWWPAIQCCSCLVRDATWREGFL 35E1ACF95F5DBA6B sept5-sept11 4 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association SEPT5 was found to interact with SEPT11 in human brain, human fetal brain and human heart cDNA libraries. sept5-sept8 4 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association SEPT5 was found to interact with SEPT8 in human brain and human fetal brain cDNA libraries. sept11-sept5 4 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association SEPT11 was found to interact with SEPT5 human heart cDNA library but not in human brain cDNA library. sept5-sept11-1 2 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait Q99719:p.[Gly56del;Lys57del;Ser58Asn] 56Gly del 57 Lys del Ser58Asn mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain K . certain certain sequence position certain certain certain sequence position certain G . certain certain sequence position certain certain certain sequence position certain S N Fri Jul 22 11:08:00 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys57del,gly56del,ser58asn' Wed May 02 15:10:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly56del,lys57del,ser58asn' Tue Jun 30 20:20:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly56del;Lys57del;Ser58Asn]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 1 C. sept5-sept8-1 2 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-958143]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 509-509, sequence length 483 [EBI-958143]5-509 physical association physical association Figure 1 A. sept5-sept11-2 3 5 unspecified role unspecified role prey prey human-jurkat Homo sapiens jurkat Human T cell leukemia 6 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 2. sept5-sept11-3 1 6 unspecified role unspecified role fluorescence donor fluorescence donor n terminal enhanced cyan fluorescence protein tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept n terminal enhanced yellow fluorscent protein tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 3 sept11-sept5-1 2 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9NVA2:p.Ser55Asn mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S N Wed May 02 20:23:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser55asn' Tue Jun 30 16:01:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser55Asn' 6 unspecified role unspecified role prey prey physical association physical association Figure 1 B.