IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mammalian APH-1 interacts with presenilin and nicastrin and is required for intramembrane proteolysis of amyloid-beta precursor protein and Notch Mammalian APH-1 interacts with presenilin and nicastrin and is required for intramembrane proteolysis of amyloid-beta precursor protein and Notch The Journal of Biological Chemistry 2002 imex curation Sheu-Fen Lee, Sanjiv Shah, Hongqiao Li, Cong Yu, Weiping Han and Gang Yu Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Synapse - Interactions of proteins with an established role in the presynapse. Apoptosis - Interactions involving proteins with a function related to apoptosis Alzheimers - Interactions investigated in the context of Alzheimers disease Immunoprecipiation from HEK293 cell extract. Tagged proteins identified using anti-tag antibodies. Gang.Yu@UTSouthwestern.edu. 25-Jun-2010: Contacted by JYOTI. myc-his tagged immobilized recombinant human protein treated with HEK293 cell extract jyoti Only protein-protein interactions Curation by: Molecular Connections Pvt. Ltd human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sheu-Fen Lee, Sanjiv Shah, Hongqiao Li, Cong Yu, Weiping Han and Gang Yu Synapse - Interactions of proteins with an established role in the presynapse. Immunoprecipiation from HEK293 cell extract. Tagged proteins identified using anti-tag antibodies. Gang.Yu@UTSouthwestern.edu. Accepted 2010-MAR-25 by SKERRIEN. 25-Jun-2010: Contacted by JYOTI. myc-his tagged immobilized recombinant human protein treated with HEK293 cell extract The Journal of Biological Chemistry 2002 jyoti Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd Mammalian APH-1 interacts with presenilin and nicastrin and is required for intramembrane proteolysis of amyloid-beta precursor protein and Notch Mammalian APH-1 interacts with presenilin and nicastrin and is required for intramembrane proteolysis of amyloid-beta precursor protein and Notch The Journal of Biological Chemistry 2002 imex curation Sheu-Fen Lee, Sanjiv Shah, Hongqiao Li, Cong Yu, Weiping Han and Gang Yu Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Synapse - Interactions of proteins with an established role in the presynapse. Apoptosis - Interactions involving proteins with a function related to apoptosis Alzheimers - Interactions investigated in the context of Alzheimers disease Immunoprecipiation from HEK293 cell extract. Tagged proteins identified using anti-tag antibodies. Gang.Yu@UTSouthwestern.edu. 25-Jun-2010: Contacted by JYOTI. myc-his tagged immobilized recombinant human protein treated with HEK293 cell extract jyoti Only protein-protein interactions Curation by: Molecular Connections Pvt. Ltd human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down western blot western blot Immuno blot Immuno blot Sheu-Fen Lee, Sanjiv Shah, Hongqiao Li, Cong Yu, Weiping Han and Gang Yu Synapse - Interactions of proteins with an established role in the presynapse. Immunoprecipiation from HEK293 cell extract. Tagged proteins identified using anti-tag antibodies. Gang.Yu@UTSouthwestern.edu. Accepted 2010-MAR-25 by SKERRIEN. 25-Jun-2010: Contacted by JYOTI. myc-his tagged immobilized recombinant human protein treated with HEK293 cell extract The Journal of Biological Chemistry 2002 jyoti Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd Mammalian APH-1 interacts with presenilin and nicastrin and is required for intramembrane proteolysis of amyloid-beta precursor protein and Notch Mammalian APH-1 interacts with presenilin and nicastrin and is required for intramembrane proteolysis of amyloid-beta precursor protein and Notch The Journal of Biological Chemistry 2002 imex curation Sheu-Fen Lee, Sanjiv Shah, Hongqiao Li, Cong Yu, Weiping Han and Gang Yu Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Synapse - Interactions of proteins with an established role in the presynapse. Apoptosis - Interactions involving proteins with a function related to apoptosis Alzheimers - Interactions investigated in the context of Alzheimers disease Immunoprecipiation from HEK293 cell extract. Tagged proteins identified using anti-tag antibodies. Gang.Yu@UTSouthwestern.edu. 25-Jun-2010: Contacted by JYOTI. myc-his tagged immobilized recombinant human protein treated with HEK293 cell extract jyoti Only protein-protein interactions Curation by: Molecular Connections Pvt. Ltd rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sheu-Fen Lee, Sanjiv Shah, Hongqiao Li, Cong Yu, Weiping Han and Gang Yu Synapse - Interactions of proteins with an established role in the presynapse. Immunoprecipiation from HEK293 cell extract. Tagged proteins identified using anti-tag antibodies. Gang.Yu@UTSouthwestern.edu. Accepted 2010-MAR-25 by SKERRIEN. 25-Jun-2010: Contacted by JYOTI. myc-his tagged immobilized recombinant human protein treated with HEK293 cell extract The Journal of Biological Chemistry 2002 jyoti Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd Mammalian APH-1 interacts with presenilin and nicastrin and is required for intramembrane proteolysis of amyloid-beta precursor protein and Notch Mammalian APH-1 interacts with presenilin and nicastrin and is required for intramembrane proteolysis of amyloid-beta precursor protein and Notch The Journal of Biological Chemistry 2002 imex curation Sheu-Fen Lee, Sanjiv Shah, Hongqiao Li, Cong Yu, Weiping Han and Gang Yu Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Synapse - Interactions of proteins with an established role in the presynapse. Apoptosis - Interactions involving proteins with a function related to apoptosis Alzheimers - Interactions investigated in the context of Alzheimers disease Immunoprecipiation from HEK293 cell extract. Tagged proteins identified using anti-tag antibodies. Gang.Yu@UTSouthwestern.edu. 25-Jun-2010: Contacted by JYOTI. myc-his tagged immobilized recombinant human protein treated with HEK293 cell extract jyoti Only protein-protein interactions Curation by: Molecular Connections Pvt. Ltd human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sheu-Fen Lee, Sanjiv Shah, Hongqiao Li, Cong Yu, Weiping Han and Gang Yu Synapse - Interactions of proteins with an established role in the presynapse. Immunoprecipiation from HEK293 cell extract. Tagged proteins identified using anti-tag antibodies. Gang.Yu@UTSouthwestern.edu. Accepted 2010-MAR-25 by SKERRIEN. myc-his tagged immobilized recombinant human protein treated with HEK293 cell extract The Journal of Biological Chemistry 2002 jyoti Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd q5pqq3_rat Aph1a rCG_52020 protein protein rat Rattus norvegicus (Rat) Rat MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFVTAGGSLRSIQRSLSCKD 8EFA9EE1FC1EA4A0 aph1a_human Gamma-secretase subunit APH-1A APH1A PSF Aph-1alpha Presenilin-stabilization factor CGI-78 UNQ579/PRO1141 protein protein human Homo sapiens Human MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCRRQEDSRVMVYSALRIPPED DIP protein Q96BI3 original sequence version: 131 8E37984A1DECC263 q96bi3-1 Gamma-secretase subunit APH-1A APH1A PSF Aph-1alpha Presenilin-stabilization factor CGI-78 UNQ579/PRO1141 L Aph-alpha1 protein protein human Homo sapiens Human MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCRRQEDSRVMVYSALRIPPED 8E37984A1DECC263 p49810-pro_0000025603 Presenilin-2 NTF subunit AD3LP AD5 E5-1 STM-2 PSEN2 AD4 PS2 PSNL2 STM2 protein protein human Homo sapiens Human MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGPEDGENTAQWRSQENEEDGEEDPDRYVCSGVPGRPPGLEEELTLKYGAKHVIMLFVPVTLCMIVVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIVVMTIFLVVLYKYRCYKFIHGWLIMSSLMLLFLFTYIYLGEVLKTYNVAMDYPTLLLTVWNFGAVGMVCIHWKGPLVLQQAYLIMISALMALVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIFPALIYSSA 1 297 104E315E38E10D12 p97887-pro_0000025600 Presenilin-1 CTF subunit Psen1 Psnl1 Protein S182 protein protein rat Rattus norvegicus (Rat) Rat AEGDPEAQRRVPKNPKYSTQGTEREETQDTGTGSDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSGSILTSEDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLIFYFATDYLVQPFMDQLAFHQFYI 299 468 C19336F98328F63A nica_rat Nicastrin Ncstn protein protein rat Rattus norvegicus (Rat) Rat MATARGGSGPDPGSRGLLLLSFSVVLAGLCGGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEDDLKWVLTDGPNPPYMVLLEGKLFTRDIMEKLKGETSRIAGLAVTLAKPNSTSSFSPSVQCPNDGFGIYSNSYGPEFAHCKKTLWNELGNGLAYDDFSFPIFLLEDENETKVIKQCYQDHNLGQNGSAPSFPLCAMQLFSHMHAVISTATCMRRSFIQSTFSINPEIVCDPLSDYNVWSMLKPINTSGGLEPDVRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALHKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMENGKFPVRLENIDSFVELGQVALRTSLELWMHTDPMSQKNESVKNQVEDLLVTLEQSGADTPQVVLSRLVQSQALPPSSLQRFLRARNISGVVLADHSGSFHNRYYQSIYDTAENINVTYPESQSPEEDLNFVTDTAKALADVATVLARALYKLAGGTNFNNSIQADPQTVTRLLYGFLVRANNSWFQSILRHDLRSYLDDGPLQHYIAVSSPTNTTYVVQYALANLTGKVTNLTQEQCQDPSKVPNESKDLYEYSWVQGPWNSNKTERLPRCVRSTVRLARALSPAFELSQWSSTEYSTWAESRWKDIQARIFLIASKELEFITLIVGFSILVFSLIVTYCINAKADVLFVAPREPGAVSY 023713E3526F393F p49768-pro_0000025591 Presenilin-1 NTF subunit PSEN1 AD3 PS1 PSNL1 Protein S182 protein protein human Homo sapiens Human MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKYLPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNM 1 298 58C420367AAEC20B p97887-pro_0000025599 Presenilin-1 NTF subunit Psen1 Psnl1 Protein S182 protein protein rat Rattus norvegicus (Rat) Rat MTEIPAPLSYFQNAQMSEDSHSSSVRSQNDNQERQQHHDRQRLDNPESISNGRPQSNFTRQVIEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYKVIHAWLIVSSLLLLFFFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGMIAIHWKGPLRLQQAYLIMISALMALVFIKYLPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNM 1 298 5DD6EE5705C9DC6E aph1b_human Gamma-secretase subunit APH-1B APH1B PSFL Aph-1beta Presenilin-stabilization factor-like UNQ688/PRO1328 protein protein human Homo sapiens Human MTAAVFFGCAFIAFGPALALYVFTIATEPLRIIFLIAGAFFWLVSLLISSLVWFMARVIIDNKDGPTQKYLLIFGAFVSVYIQEMFRFAYYKLLKKASEGLKSINPGETAPSMRLLAYVSGLGFGIMSGVFSFVNTLSDSLGPGTVGIHGDSPQFFLYSAFMTLVIILLHVFWGIVFFDGCEKKKWGILLIVLLTHLLVSAQTFISSYYGINLASAFIILVLMGTWAFLAAGGSCRSLKLCLLCQDKNFLLYNQRSR A7A0C0076E20990A nica_human Nicastrin NCSTN KIAA0253 UNQ1874/PRO4317 protein protein human Homo sapiens Human MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCREIQWNSLGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTFSINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLATLEKSGAGVPAVILRRPNQSQPLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFVTDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQDLRSYLGDGPLQHYIAVSSPTNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLYEYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQWSSTEYSTWTESRWKDIRARIFLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY DIP protein Q92542 original sequence version: 74 DIP protein Q92542 original sequence version: 146 C8C0EAEAD89E976A p49768-pro_0000025592 Presenilin-1 CTF subunit PSEN1 AD3 PS1 PSNL1 Protein S182 protein protein human Homo sapiens Human AEGDPEAQRRVSKNSKYNAESTERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI 299 467 3E9D952750443B00 ncstn-psen1 4 11 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association fig 2A ncstn-psen2 4 7 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association fig 2A psen1-psen1 4 15 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction fig 2A aph1a-psen2 1 8 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association fig 2A psen1-psen1-1 3 9 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey physical association physical association fig 3B psen1-ncstn-1 3 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association fig 3C aph1a-ncstn 3 5 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association fig 3C aph1a-psen1 3 9 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association fig 3D aph1b-psen2 2 13 unspecified role unspecified role bait bait c-term myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role prey prey physical association physical association fig 2B