UniProt UniProt http://www.uniprot.org Saccharomyces cerevisiae Pra1p/Yip3p interacts with Yip1p and Rab proteins. Saccharomyces cerevisiae Pra1p/Yip3p interacts with Yip1p and Rab proteins. Biochem. Biophys. Res. Commun. 290 (676-681) 2002 imex curation Calero M., Collins RN. Synapse - Interactions of proteins with an established role in the presynapse. rnc8@cornell.edu 27-Aug-2008: Contacted by JYOTI. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Calero M., Collins RN. Synapse - Interactions of proteins with an established role in the presynapse. rnc8@cornell.edu Accepted 2008-AUG-22 by DAVET. Biochem. Biophys. Res. Commun. 290 (676-681) 2002 davet Only protein-protein interactions imex curation Saccharomyces cerevisiae Pra1p/Yip3p interacts with Yip1p and Rab proteins. Saccharomyces cerevisiae Pra1p/Yip3p interacts with Yip1p and Rab proteins. Biochem. Biophys. Res. Commun. 290 (676-681) 2002 imex curation Calero M., Collins RN. Synapse - Interactions of proteins with an established role in the presynapse. rnc8@cornell.edu 27-Aug-2008: Contacted by JYOTI. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Calero M., Collins RN. Synapse - Interactions of proteins with an established role in the presynapse. rnc8@cornell.edu Accepted 2008-AUG-22 by DAVET. 27-Aug-2008: Contacted by JYOTI. Biochem. Biophys. Res. Commun. 290 (676-681) 2002 davet Only protein-protein interactions imex curation rab1a_canlf Ras-related protein Rab-1A RAB1A RAB1 protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC B2A8F4E3B0FB17D6 ypt11_yeast GTP-binding protein YPT11 YPT11 YNL304W N0410 Rab GTPase YPT11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQRKRYSLNVVTSPSIPSPTPSAPIRTNESNWEAASPASAASSFLPNVHHGGTVLNPGLGIMRSPSLNKSGAFGRSGSSGSSTVIEPSNIKLLLIGDANVGKTAMILSYCRELLTRAEMSRSARLRHQQQQQHKDLGLKKTVVNHRLSMKEKRKRYSSNDFEKEFKDINHFADETSDFGNPNIGDDNNHEMADPNEIVIETRSTIGIDIKTNLVNIDNRFFNVILWDTAGQERYQNAIIPSLYKKTNAVILTYDITNAKSFQSCMERWIVQALENFSSQDLLKARFFLVGNKIDLYKERQVTHYDVVQMVQEMQLKHGIKISGNFEVSCKWVNVVERTMNMIILDLVENGCFENNDPCVSITTSDDVQGHEQEFHDTVEEPFNFTRQRQHQLEKNNTVDITKPNDDIANNQSICCV 26055FCE32A64977 ypt10_yeast GTP-binding protein YPT10 YPT10 YBR1733 YBR264C protein protein yeast Saccharomyces cerevisiae Baker's yeast MEATIKVVLLGDSSVGKTSIVTRLKSGKFLAKHAATIGAAFITKTIEVPSNDSSTEKRIHMEIWDTAGQERYKSLVPMYYRDANIALIVFELGDVSSLQCAKTWFQDLQDRAQGTQVIIVGNKYDLVCEEHSGEVTIPAELQGLPYVAVSAKTGYNFDTLNKIIISLVPESQFKTLSKNNEQGNILEINKKKSGSGCIC EE66719A8C65AA54 EE66719A8C65AA54 ypt52_yeast GTP-binding protein YPT52 YPT52 YK112 YKR014C protein protein yeast Saccharomyces cerevisiae Baker's yeast MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVKEIFQDIGEKLYDLKKDEILSKQNRQIGGGNNGQVDINLQRPSTNDPTSCCS 34AB2FFE38697261 34AB2FFE38697261 ypt7_yeast Ypt/Rab-type GTPase YPT7 YPT7 VAM4 Vacuolar morphology protein 4 YM8270.02 YML001W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQADTEAFEDDYNDAINIRLDGENNSCSC 0E2B72BDA7F7CEE5 0E2B72BDA7F7CEE5 ypt6_yeast GTP-binding protein YPT6 L8479.11 YLR262C YPT6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRSGKSLTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGNKSDLSDERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKIAKSLPEFQNSESTPLDSENANSANQNKPGVIDISTAEEQEQSACQC A8E6211FF24FAE0B A8E6211FF24FAE0B ypt1_yeast GTP-binding protein YPT1 YFL038C YPT1 YP2 Rab GTPase YPT1 Transport GTPase YPT1 Protein YP2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC F8C704F6BF2D227B F8C704F6BF2D227B vps21_yeast Vacuolar protein sorting-associated protein 21 GTP-binding protein YPT51 Vacuolar protein-targeting protein 12 VPS21 YOR089C YOR3154C VPS12 VPT12 YPT21 YPT51 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNTSVTSIKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGNKIDMLQEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPLKTAEEQNSASNERESNNQRVDLNAANDGTSANSACSC 34D7DA0090C33F09 34D7DA0090C33F09 ypt32_yeast GTP-binding protein YPT32/YPT11 Rab GTPase YPT32 YPT32 YPT11 YGL210W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNEDYGYDYDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSKHQVDLSGSGTNNMGSNGAPKGPTISLTPAPKEDKKKKSSNCC 621217A296161964 621217A296161964 pra1_yeast Prenylated Rab acceptor 1 YIP3 PRA1 YNL044W N2650 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNQLGALAQVSRFTQNFSMENIKSEFQSLQSKLATLRTPQEFFNFKKISKPQNFGEVQSRVAYNLKYFSSNYGLIIGCLSIYTLLTNLLLLFVIVLVVAGIVGINKLKGEELVTPFGSFKTNQLYTGLVCVAVPIGFLASPISTLLWLIGASAVSVFGHASLMEKPIETVFDEETV C88401CB23197CD8 C88401CB23197CD8 sec4_yeast Ras-related protein SEC4 SEC4 SRO6 Suppressor of RHO3 protein 6 YFL005W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGLRTVSASSGNGKSYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLVGVGNGKEGNISINSGSGNSSKSNCC 7DEDF7DCC7533BA7 7DEDF7DCC7533BA7 gdi1_yeast Rab GDP-dissociation inhibitor YER136W GDI1 SEC19 Secretory pathway GDP dissociation inhibitor protein protein yeast Saccharomyces cerevisiae Baker's yeast MDQETIDTDYDVIVLGTGITECILSGLLSVDGKKVLHIDKQDHYGGEAASVTLSQLYEKFKQNPISKEERESKFGKDRDWNVDLIPKFLMANGELTNILIHTDVTRYVDFKQVSGSYVFKQGKIYKVPANEIEAISSPLMGIFEKRRMKKFLEWISSYKEDDLSTHQGLDLDKNTMDEVYYKFGLGNSTKEFIGHAMALWTNDDYLQQPARPSFERILLYCQSVARYGKSPYLYPMYGLGELPQGFARLSAIYGGTYMLDTPIDEVLYKKDTGKFEGVKTKLGTFKAPLVIADPTYFPEKCKSTGQRVIRAICILNHPVPNTSNADSLQIIIPQSQLGRKSDIYVAIVSDAHNVCSKGHYLAIISTIIETDKPHIELEPAFKLLGPIEEKFMGIAELFEPREDGSKDNIYLSRSYDASSHFESMTDDVKDIYFRVTGHPLVLKQRQEQEKQ 48CF8D45FC031772 48CF8D45FC031772 yip1_yeast Protein transport protein YIP1 YIP1 YGR172C YPT-interacting protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFYNTSNNANNGGGFYQPSAQFAVPQGSMSFQNTVGSSNTGNDNNLGVAPDPLPVGILHALSTKGYPHEPPLLEEIGINFDHIITKTKMVLIPIRFGSGVPQEILNDSDLAGPLIFFLLFGLFLLMAGKVHFGYIYGVALFGTISLHNLSKLMSNNDTSTQTNLQFFNTASILGYCFLPLCFLSLLGIFHGLNNTTGYVVSVLFVIWSTWTSSGFLNSLLQLQNARLLIAYPLLIFYSVFALMVIFV 64372B4823A0BC5E 64372B4823A0BC5E rab5a_human Ras-related protein Rab-5A RAB5A RAB5 protein protein human Homo sapiens Human MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN DIP protein P20339 original sequence version: 100 EC03DDF96BBEF821 ypt53_yeast GTP-binding protein YPT53 YPT53 N2223 YNL093W protein protein yeast Saccharomyces cerevisiae Baker's yeast MDKHTAAIPTLTIKVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKRITRDGKVIKFEIWDTAGQERFAPLAPMYYRNAQAALVVFDVTNEGSFYKAQNWVEELHEKVGHDIVIALVGNKMDLLNNDDENENRAMKAPAVQNLCERENLLYFEASAKTGENIYQIFQTLGEKVPCPEQNTRQSSTHDRTITDNQRIDLESTTVESTRETGGCNC ABA1D926D1EE9F68 ABA1D926D1EE9F68 ypt31_yeast GTP-binding protein YPT31/YPT8 Rab GTPase YPT31 YPT31 YPT8 YER031C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSEDYGYDYDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQKVSKHQMDLGDSSANGNANGASAPNGPTISLTPTPNENKKANGNNCC EC274E5873138D78 EC274E5873138D78 yip3-ypt6 1 8 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey c-terminus exon2 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 yip3-ypt11 1 12 unspecified role unspecified role prey prey c-terminus exon2 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait physical association physical association Table 2 yip3-ypt52 1 6 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey c-terminus exon2 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 yip3-ypt53 1 12 unspecified role unspecified role prey prey c-terminus exon2 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role bait bait physical association physical association Table 2 yip3-ypt1 1 12 unspecified role unspecified role prey prey c-terminus exon2 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait physical association physical association Table 2 yip3-ypt51 1 12 unspecified role unspecified role prey prey c-terminus exon2 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait physical association physical association Table 2 yip3-sec4 1 13 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey c-terminus exon2 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 yip3-ypt31 1 12 unspecified role unspecified role prey prey c-terminus exon2 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role bait bait physical association physical association Table 2 yip3-ypt32 1 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey c-terminus exon2 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 yip3-ypt10 1 5 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey c-terminus exon2 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 yip3-rab1 1 3 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey c-terminus exon2 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 yip3-rab5 1 16 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey c-terminus exon2 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 gdi1-rab5 1 16 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association Table 2 gdi1-rab1 1 3 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association Table 2 gdi1-ypt10 1 5 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association Table 2 gdi1-ypt32 1 11 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association Table 2 gdi1-ypt31 1 18 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association Table 2 gdi1-sec4 1 14 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association Table 2 gdi1-ypt51 1 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Table 2 gdi1-ypt1-2 1 14 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Table 2 gdi1-ypt53 1 14 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association Table 2 gdi1-ypt52 1 14 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Table 2 gdi1-ypt11 1 14 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Table 2 The interaction is very weak, beta-gal activity was detected after 5h. gdi1-ypt7 1 7 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association Table 2 The interaction is very weak, beta-gal activity was detected after 5h. gdi1-ypt6 1 14 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Table 2 yip3-ypt10-1 2 12 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1A yip3-ypt11-1 2 4 unspecified role unspecified role prey prey n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1A yip3-ypt31-1 2 18 unspecified role unspecified role prey prey n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1A yip3-ypt32-1 2 11 unspecified role unspecified role prey prey n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1A yip3-ypt52-1 2 6 unspecified role unspecified role prey prey n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1A yip3-ypt6-1 2 8 unspecified role unspecified role prey prey n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1A yip3-sec4-1 2 12 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 13 unspecified role unspecified role prey prey n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1A yip3-ypt1-1 2 12 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role prey prey n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1A and 1C The C-terminus is required for the interaction to occur. yip3-yip1 2 12 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role prey prey n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 3