IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Bipartite interaction between neurofibromatosis type I protein (neurofibromin) and syndecan transmembrane heparan sulfate proteoglycans. Bipartite interaction between neurofibromatosis type I protein (neurofibromin) and syndecan transmembrane heparan sulfate proteoglycans. J. Neurosci. (0270-6474) 2001 imex curation Hsueh YP., Roberts AM., Volta M., Sheng M., Roberts RG. Synapse - Interactions of proteins with an established role in the presynapse. Cancer - Interactions investigated in the context of cancer yph@gate.sinica.edu.tw 08-DEC-2006: Contacted by JYOTI. cDNA libraries from adult and fetal human brain (Clontech) were used. Only protein-protein interactions rat-brain Rattus norvegicus brain brain Brain [cerebrum] confocal microscopy confocal microscopy immunostaining immunostaining Hsueh YP., Roberts AM., Volta M., Sheng M., Roberts RG. Synapse - Interactions of proteins with an established role in the presynapse. The species of the cultured neurons was not given and thus these colocalizations are not curated. yph@gate.sinica.edu.tw Accepted 2006-DEC-4 by JYOTI. 08-DEC-2006: Contacted by JYOTI. cDNA libraries from adult and fetal human brain (Clontech) were used. J. Neurosci. (0270-6474) 2001 Only protein-protein interactions imex curation Bipartite interaction between neurofibromatosis type I protein (neurofibromin) and syndecan transmembrane heparan sulfate proteoglycans. Bipartite interaction between neurofibromatosis type I protein (neurofibromin) and syndecan transmembrane heparan sulfate proteoglycans. J. Neurosci. (0270-6474) 2001 imex curation Hsueh YP., Roberts AM., Volta M., Sheng M., Roberts RG. Synapse - Interactions of proteins with an established role in the presynapse. Cancer - Interactions investigated in the context of cancer yph@gate.sinica.edu.tw 08-DEC-2006: Contacted by JYOTI. cDNA libraries from adult and fetal human brain (Clontech) were used. Only protein-protein interactions rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hsueh YP., Roberts AM., Volta M., Sheng M., Roberts RG. Synapse - Interactions of proteins with an established role in the presynapse. yph@gate.sinica.edu.tw Accepted 2006-DEC-4 by JYOTI. 08-DEC-2006: Contacted by JYOTI. cDNA libraries from adult and fetal human brain (Clontech) were used. J. Neurosci. (0270-6474) 2001 Only protein-protein interactions imex curation Bipartite interaction between neurofibromatosis type I protein (neurofibromin) and syndecan transmembrane heparan sulfate proteoglycans. Bipartite interaction between neurofibromatosis type I protein (neurofibromin) and syndecan transmembrane heparan sulfate proteoglycans. J. Neurosci. (0270-6474) 2001 imex curation Hsueh YP., Roberts AM., Volta M., Sheng M., Roberts RG. Synapse - Interactions of proteins with an established role in the presynapse. Cancer - Interactions investigated in the context of cancer yph@gate.sinica.edu.tw 08-DEC-2006: Contacted by JYOTI. cDNA libraries from adult and fetal human brain (Clontech) were used. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hsueh YP., Roberts AM., Volta M., Sheng M., Roberts RG. Synapse - Interactions of proteins with an established role in the presynapse. yph@gate.sinica.edu.tw Accepted 2006-DEC-4 by JYOTI. 08-DEC-2006: Contacted by JYOTI. cDNA libraries from adult and fetal human brain (Clontech) were used. J. Neurosci. (0270-6474) 2001 Only protein-protein interactions imex curation Bipartite interaction between neurofibromatosis type I protein (neurofibromin) and syndecan transmembrane heparan sulfate proteoglycans. Bipartite interaction between neurofibromatosis type I protein (neurofibromin) and syndecan transmembrane heparan sulfate proteoglycans. J. Neurosci. (0270-6474) 2001 imex curation Hsueh YP., Roberts AM., Volta M., Sheng M., Roberts RG. Synapse - Interactions of proteins with an established role in the presynapse. Cancer - Interactions investigated in the context of cancer yph@gate.sinica.edu.tw 08-DEC-2006: Contacted by JYOTI. cDNA libraries from adult and fetal human brain (Clontech) were used. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hsueh YP., Roberts AM., Volta M., Sheng M., Roberts RG. Synapse - Interactions of proteins with an established role in the presynapse. One-week old rat brain homogenate was incubated with glutathione agarose prebound with GST fusion protein. yph@gate.sinica.edu.tw Accepted 2006-DEC-4 by JYOTI. 08-DEC-2006: Contacted by JYOTI. cDNA libraries from adult and fetal human brain (Clontech) were used. J. Neurosci. (0270-6474) 2001 Only protein-protein interactions imex curation Bipartite interaction between neurofibromatosis type I protein (neurofibromin) and syndecan transmembrane heparan sulfate proteoglycans. Bipartite interaction between neurofibromatosis type I protein (neurofibromin) and syndecan transmembrane heparan sulfate proteoglycans. J. Neurosci. (0270-6474) 2001 imex curation Hsueh YP., Roberts AM., Volta M., Sheng M., Roberts RG. Synapse - Interactions of proteins with an established role in the presynapse. Cancer - Interactions investigated in the context of cancer yph@gate.sinica.edu.tw 08-DEC-2006: Contacted by JYOTI. cDNA libraries from adult and fetal human brain (Clontech) were used. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hsueh YP., Roberts AM., Volta M., Sheng M., Roberts RG. Synapse - Interactions of proteins with an established role in the presynapse. The species of origin of the CASK construct is not specified in the paper and thus the interactions with the CASK bait are not curated. yph@gate.sinica.edu.tw Accepted 2006-DEC-4 by JYOTI. 08-DEC-2006: Contacted by JYOTI. cDNA libraries from adult and fetal human brain (Clontech) were used. J. Neurosci. (0270-6474) 2001 Only protein-protein interactions imex curation sdc1_rat Syndecan-1 Sdc1 Synd1 protein protein rat Rattus norvegicus (Rat) Rat MRRAALWLWLCALALRLQPALPQIVTANVPPEDQDGSGDDSDNFSGSGTGALPDMTLSRQTPSTWKDVWLLTATPTAPEPTSRDTEATLTSILPAGEKPEEGEPVAHVEAEPDFTARDKEKEATTRPRETTQLPVTQQASTAARATTAQASVTSHPHGDVQPGLHETLAPTAPGQPDHQPPSVEDGGTSVIKEVVEDETTNQLPAGEGSGEQDFTFETSGENTAVAGVEPDLRNQSPVDEGATGASQGLLDRKEVLGGVIAGGLVGLIFAVCLVAFMLYRMKKKDEGSYSLEEPKQANGGAYQKPTKQEEFYA C6EC50E8798A5218 nf1_rat Neurofibromin Nf1 Neurofibromatosis-related protein NF-1 protein protein rat Rattus norvegicus (Rat) Rat MAAHRPVEWVQAVVSRFDEQLPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNMRIFGEAAEKNLYLSQLIILDTLEKCLAGQPKDTMRLDETMLVKQLLPEICHFLHTCREGNQHAAELRNSASGVLFSLSCNNFNAVFSRISTRLQELTVCSEDNVDVHDIELLQYINVDCAKLKRLLKETAFKFKALKKVAQLAVINSLEKAFWNWVENYPDEFTKLYQIPQTDMAECAGKLFDLVDGFAESTKRKAAVWPLQIILLILCPEIIQDISRDVVDENNTNKKLFLDSLRKALAGHGGSRQLTESAAIACVKLCKASTYINWEDNSVIFLLVQSMVVDLKNLLFNPSKPFSRGSQPADVDLMIDCLVSCFRISPHNNQHFKICLAQNSPSTFHYVLVNSLHRIITNSAWDWWPKIDAVYCHSVELRNMFGETLHKAVQGCGAHPALRMAPSLTFKEKVTSLKFKEKPTDLEARSYKYLLLSMVKLIHADPKLLLCNPRKQGPETQGSTAELITGLVQLVPQSHMPEVAQEAMEALLVLHQLDSIDLWNPDAPVETFWEISSQMLFYICKKLTSHQMLSSTEILKWLREILICRNKFLLKNKQADRSSCHSLYLYGVGCDLPASGNVTQMSVDHEESLRTCAPGASLRKGRGNSSMDSTAGCSGTPPICRQAQTKLEVALYMFLWSPDTEVVLVAMSCFRHLCEEADIRCGVDEVSVHNFLPNYNTFMEFASVSNMLSTGRAALQKRVMALLRRIEHPTAGNTEAWEDTHAKWEQATKLILNYPKAKMEDGQAAESLHKTIVKRRMSHVSGGGSIDLSDTDSLQEWINMTGFLCALGGVCLQQRSSSGLATYSPPMGPVSERKGSMISVMSSEGNVDSPVSRFMDRLLSLMVCNHEKVGLQIRTNVKDLVGLELSPALYPMLFNKLKSAISKFFDSQGQVLLTDSNTQFVEQTIAIMKNLLDNHTEGSSEHLGQASIETMMLNLVRYVRVLGNMVHAIQIKTKLCQLVEVMMARRDDLSFCQEMKFRNKMVEYLTDWVMGTSNQAADDDVKCLTRDLDQASMEAVVSLLAGLPLQPEEGDGVELMEAKSQLFLKYFTLFMNLLNDCSEVEDENAQTGGRKRGMSRRLASLRHCTVLAMSNLLNANVDSGLMHSIGLGYHKDLQTRATFMEVLTKILQQGTEFDTLAETVLADRFERLVELVTMMGDQGELPIAMALANVVPCSQWDELARVLVTLFDSRHLLYQLLWNMFSKEVELADSMQTLFRGNSLASKIMTFCFKVYGATYLQKLLDPLLRIIITSSDWQHVSFEVDPTRLEPSESLEENQRNLLQMTEKFFHAIISSSSEFPSQLRSVCHCLYQVVSQRFPQNSIGAVGSAMFLRFINPAIVSPYEAGILDKKPPPRIERGLKLMSKVLQSIANHVLFTKEEHMRPFNDFVKSNFDLARRFFLDIASDCPTSDAVNHSLSFISDGNVLALHRLLWNNQEKIGQYLSSNRDHKAVGRRPFDKMATLLAYLGPPEHKPVADTHWSSLNLTSSKFEEFMTRHQVHEKEEFKALKTLSIFYQAGTSKAGNPIFYYVARRFKTGQINGDLLIYHVLLTLKPYYAKPYEIVVDLTHTGPSNRFKTDFLSKWFVVFPGFAYDNVSAVYIYNCNSWVREYTKYHERLLTGLKGSKRLIFIDCPGKLAEHIEHEQQKLPAATLALEEDLKVFHNALKLAHKDTKVSIKVGSTAVQVTSAERTKVLGQSVFLNDIYYASEIEEICLVDENQFTLTIANQGTPLTFMHQECEAIVQSIIHIRTRWELSQPDSIPQHTKIRPKDVPGTLLNIALLNLGSSDPSLRSAAYNLLCALTCTFNLKIEGQLLETSGLCIPANNTLFIVSISKTLAANEPHLTLEFLEECISGFSKSSIELKHLCLEYMTPWLSNLVRFCKHNDDAKRQRVTAILDKLITMTINEKQMYPSIQAKIWGSLGQITDLLDVVLDSFIKTSATGGLGSIKAEVMADTAVALASGNVKLVSSKVIGRMCKIIDKTCLSPTPTLEQHLMWDDIAILARYMLMLSFNNSLDVAAHLPYLFHVVTFLVATGPLSLRASTHGLVINIIHSLCTCSQLHFSEETKQVLRLSLTEFSLPKFYLLFGISKVKSAAVIAFRSSYRDRSFSPGSYERETFALTSLETVTEALLEIMEACMRDIPTCKWLDQWTELAQRFAFQYNPSLQPRALVVFGCISKRVSHGQIKQIIRILSKALESCLKGPDTYNSQVLIEATVIALTKLQPLLNKDSPLHKALFWVAVAVLQLDEVNLYSAGTALLEQNLHTLDSLRIFNDKSPEEVFMAIRNPLEWHCKQMDHFVGLNFNSNFNFALVGHLLKGYRHPSPAIVARTVRILHTLLTLVNKHRNCDKFEVNTQSVAYLAALLTVSEEVRSRCSLKHRKSLLLTDISMENVPMDTYPIHHGDPSSRTLKETQPWSSPRGSEGYLAATYPAVGQTSPRARKSMSLDMGQPSQANTKKLLGTRKSFDHLISDTKAPKRQEMESGITTPPKMRRVAETDYEMETQRISSSQQHPHLRKVSVSESNVLLDEEVLTDPKIQALLLTVLATLVKYTTDEFDQRILYEYLAEASVVFPKVFPLVHNLLDSKINTLLSLCQDPNLLNPIHGIVQSVVYHEESPPQYQTSYLQSFGFNGLWRFAGPFSKQTQIPDYAELIVKFLDALIDTYLPGIDEETSEESLLTPTSPYPPALQSQLSITANLNLSNSMTSLATSQHSPGIDKENVELSPTTGHCNSGRTRHGSASQVQKQRSAGSFKRNSIKKIV FC108487E86DA89F sdc2_human Syndecan-2 SDC2 HSPG1 Fibroglycan Heparan sulfate proteoglycan core protein protein protein human Homo sapiens Human MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA DIP protein P34741 original sequence version: 74 DIP protein P34741 original sequence version: 119 DIP protein P34741 original sequence version: 102 7DA4159D54741054 nf1_human Neurofibromin NF1 Neurofibromatosis-related protein NF-1 protein protein human Homo sapiens Human MAAHRPVEWVQAVVSRFDEQLPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNMRIFGEAAEKNLYLSQLIILDTLEKCLAGQPKDTMRLDETMLVKQLLPEICHFLHTCREGNQHAAELRNSASGVLFSLSCNNFNAVFSRISTRLQELTVCSEDNVDVHDIELLQYINVDCAKLKRLLKETAFKFKALKKVAQLAVINSLEKAFWNWVENYPDEFTKLYQIPQTDMAECAEKLFDLVDGFAESTKRKAAVWPLQIILLILCPEIIQDISKDVVDENNMNKKLFLDSLRKALAGHGGSRQLTESAAIACVKLCKASTYINWEDNSVIFLLVQSMVVDLKNLLFNPSKPFSRGSQPADVDLMIDCLVSCFRISPHNNQHFKICLAQNSPSTFHYVLVNSLHRIITNSALDWWPKIDAVYCHSVELRNMFGETLHKAVQGCGAHPAIRMAPSLTFKEKVTSLKFKEKPTDLETRSYKYLLLSMVKLIHADPKLLLCNPRKQGPETQGSTAELITGLVQLVPQSHMPEIAQEAMEALLVLHQLDSIDLWNPDAPVETFWEISSQMLFYICKKLTSHQMLSSTEILKWLREILICRNKFLLKNKQADRSSCHFLLFYGVGCDIPSSGNTSQMSMDHEELLRTPGASLRKGKGNSSMDSAAGCSGTPPICRQAQTKLEVALYMFLWNPDTEAVLVAMSCFRHLCEEADIRCGVDEVSVHNLLPNYNTFMEFASVSNMMSTGRAALQKRVMALLRRIEHPTAGNTEAWEDTHAKWEQATKLILNYPKAKMEDGQAAESLHKTIVKRRMSHVSGGGSIDLSDTDSLQEWINMTGFLCALGGVCLQQRSNSGLATYSPPMGPVSERKGSMISVMSSEGNADTPVSKFMDRLLSLMVCNHEKVGLQIRTNVKDLVGLELSPALYPMLFNKLKNTISKFFDSQGQVLLTDTNTQFVEQTIAIMKNLLDNHTEGSSEHLGQASIETMMLNLVRYVRVLGNMVHAIQIKTKLCQLVEVMMARRDDLSFCQEMKFRNKMVEYLTDWVMGTSNQAADDDVKCLTRDLDQASMEAVVSLLAGLPLQPEEGDGVELMEAKSQLFLKYFTLFMNLLNDCSEVEDESAQTGGRKRGMSRRLASLRHCTVLAMSNLLNANVDSGLMHSIGLGYHKDLQTRATFMEVLTKILQQGTEFDTLAETVLADRFERLVELVTMMGDQGELPIAMALANVVPCSQWDELARVLVTLFDSRHLLYQLLWNMFSKEVELADSMQTLFRGNSLASKIMTFCFKVYGATYLQKLLDPLLRIVITSSDWQHVSFEVDPTRLEPSESLEENQRNLLQMTEKFFHAIISSSSEFPPQLRSVCHCLYQATCHSLLNKATVKEKKENKKSVVSQRFPQNSIGAVGSAMFLRFINPAIVSPYEAGILDKKPPPRIERGLKLMSKILQSIANHVLFTKEEHMRPFNDFVKSNFDAARRFFLDIASDCPTSDAVNHSLSFISDGNVLALHRLLWNNQEKIGQYLSSNRDHKAVGRRPFDKMATLLAYLGPPEHKPVADTHWSSLNLTSSKFEEFMTRHQVHEKEEFKALKTLSIFYQAGTSKAGNPIFYYVARRFKTGQINGDLLIYHVLLTLKPYYAKPYEIVVDLTHTGPSNRFKTDFLSKWFVVFPGFAYDNVSAVYIYNCNSWVREYTKYHERLLTGLKGSKRLVFIDCPGKLAEHIEHEQQKLPAATLALEEDLKVFHNALKLAHKDTKVSIKVGSTAVQVTSAERTKVLGQSVFLNDIYYASEIEEICLVDENQFTLTIANQGTPLTFMHQECEAIVQSIIHIRTRWELSQPDSIPQHTKIRPKDVPGTLLNIALLNLGSSDPSLRSAAYNLLCALTCTFNLKIEGQLLETSGLCIPANNTLFIVSISKTLAANEPHLTLEFLEECISGFSKSSIELKHLCLEYMTPWLSNLVRFCKHNDDAKRQRVTAILDKLITMTINEKQMYPSIQAKIWGSLGQITDLLDVVLDSFIKTSATGGLGSIKAEVMADTAVALASGNVKLVSSKVIGRMCKIIDKTCLSPTPTLEQHLMWDDIAILARYMLMLSFNNSLDVAAHLPYLFHVVTFLVATGPLSLRASTHGLVINIIHSLCTCSQLHFSEETKQVLRLSLTEFSLPKFYLLFGISKVKSAAVIAFRSSYRDRSFSPGSYERETFALTSLETVTEALLEIMEACMRDIPTCKWLDQWTELAQRFAFQYNPSLQPRALVVFGCISKRVSHGQIKQIIRILSKALESCLKGPDTYNSQVLIEATVIALTKLQPLLNKDSPLHKALFWVAVAVLQLDEVNLYSAGTALLEQNLHTLDSLRIFNDKSPEEVFMAIRNPLEWHCKQMDHFVGLNFNSNFNFALVGHLLKGYRHPSPAIVARTVRILHTLLTLVNKHRNCDKFEVNTQSVAYLAALLTVSEEVRSRCSLKHRKSLLLTDISMENVPMDTYPIHHGDPSYRTLKETQPWSSPKGSEGYLAATYPTVGQTSPRARKSMSLDMGQPSQANTKKLLGTRKSFDHLISDTKAPKRQEMESGITTPPKMRRVAETDYEMETQRISSSQQHPHLRKVSVSESNVLLDEEVLTDPKIQALLLTVLATLVKYTTDEFDQRILYEYLAEASVVFPKVFPVVHNLLDSKINTLLSLCQDPNLLNPIHGIVQSVVYHEESPPQYQTSYLQSFGFNGLWRFAGPFSKQTQIPDYAELIVKFLDALIDTYLPGIDEETSEESLLTPTSPYPPALQSQLSITANLNLSNSMTSLATSQHSPGIDKENVELSPTTGHCNSGRTRHGSASQVQKQRSAGSFKRNSIKKIV C079475139DBD51E sdc2_rat Syndecan-2 Sdc2 Hspg1 Synd2 Fibroglycan Heparan sulfate proteoglycan core protein protein protein rat Rattus norvegicus (Rat) Rat MQRAWILLTLGLMACVSAETRAELTSDKDMYLDSSSIEEASGLYPIDDDDYSSASGSGAYEDKGSPDLTTSQLIPRISLTSAAPEVETMTLKTQSITPTQTESPEETDKKEFEISEAEEKQDPAVKSTDVYTEKHSDNLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA 02E08455754C5E5A sdc4_rat Syndecan-4 Sdc4 Synd4 Ryudocan core protein protein protein rat Rattus norvegicus (Rat) Rat MAPVCLFAPLLLLLLGGFPVAPGESIRETEVIDPQDLLEGRYFSGALPDDEDAGGLEQDSDFELSGSGDLDDTEEPRTFPEVISPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRVPSDVGDDDVSNKVSMSSTSQGSNIFERTEVLAALIVGGVVGILFAVFLILLLVYRMKKKDEGSYDLGKKPIYKKAPTNEFYA 5D9C8B3BF4C0D58A sdc3_rat Syndecan-3 Sdc3 Synd3 N-syndecan Neuroglycan protein protein rat Rattus norvegicus (Rat) Rat MKPGPPRRGTAQGQRVDTATHGPGARGLLLPPLLLLLLAGRAAGAQRWRNENFERPVDLEGSGDDDSFPDDELDDLYSGSGSGYFEQESGLETAMRFIPDIALAAPTAPAMLPTTVIQPVDTPFEELLSEHPGPEPVTSPPLVTEVTEVVEEPSQRATTISTTTSTTAATTTGAPTMATAPATAATTAPSTPAAPPATATTADIRTTGIQGLLPLPLTTAATAKATTPAVPSPPTTVTTLDTEAPTPRLVNTATSRPRALPRPVTTQEPEVAERSTLPLGTTAPGPTEVAQTPTPESLLTTTQDEPEVPVSGGPSGDFELQEETTQPDTANEVVAVEGAAAKPSPPLGTLPKGARPGLGLHDNAIDSGSSAAQLPQKSILERKEVLVAVIVGGVVGALFAAFLVTLLIYRMKKKDEGSYTLEEPKQASVTYQKPDKQEEFYA 4842C8BEAA0A338C cskp_rat Peripheral plasma membrane protein CASK Calcium/calmodulin-dependent serine protein kinase Cask protein protein rat Rattus norvegicus (Rat) Rat MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPENNDAKELKRILTQPHFMALLQTHHVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNADLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPERFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFPPFVVFIAAPTITPGLNEDESLQRLQKESDVLQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY 3694A9A44AC29629 nf1-sdc2 5 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1 A By yeast two-hybrid assays either Jn (aa 1357-1473) or Pn (aa 2619-2719) regions of neurofibromin were sufficient to interact with syndecan-2 nf1-sdc2-1 3 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range physical association physical association 1 A By yeast two-hybrid assays either Jn (aa 1357-1473) or Pn (aa 2619-2719) regions of neurofibromin were sufficient to interact with syndecan-2 THe sequence of human syndecan-2 stated by the authors to interact with neurofibromin ends at residue 211. However, the sequence in the UniprotKB (P34741) is only 201 residues in length. sdc2-nf1 4 12 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 7 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 10 unspecified role unspecified role bait bait c-terminal binding region binding-associated region binding region range range range range ecoli Escherichia coli (strain K12) association association 1 B Neurofibromin was precipitated specifically by a GST fusion of syndecan-2 (amino acid residue 33-211) containing part of the extracellular domain, plus complete transmembrane and cytoplasmic domains of rat syndecan-2 (Fig. 1B; data not shown). GST-syndecan-2D65, which lacks the C-terminal 65 amino acid residues corresponding to the transmembrane and cytoplasmic domains of syndecan-2, was unable to pull down neurofibromin from rat brain extract The sequence of syndecan-2 is stated by the authors to be 211 residues in length. However, the UniprotKB entry is only 201 residues in length. GST-syndecan- 2 also precipitated syndecan-3 from brain extracts nf1-sdc1 5 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2 A Both J/Jn and P/Pn fragments of neurofibromin were able to interact with syndecans 1-4 The interaction of neurofibromin Jn with syndecan-1 was weaker than the interaction with syndecans-2, -3 and -4. nf1-sdc2-2 5 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain P34900:p.[Arg172Ala;Lys173Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain K A Wed May 02 20:18:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg172ala,lys173ala' Tue Jun 30 19:23:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg172Ala;Lys173Ala]' P34900:p.[Lys174Ala;Asp175Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain D A Wed May 02 17:40:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys174ala,asp175ala' Tue Jun 30 16:05:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys174Ala;Asp175Ala]' P34900:p.[Glu176Ala;Gly177Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain G A Wed May 02 20:32:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu176ala,gly177ala' Tue Jun 30 17:22:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu176Ala;Gly177Ala]' P34900:p.[Ser178Ala;Tyr179Ala] mutation increasing mutation increasing interaction mutation increasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 20:02:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser178ala,tyr179ala' Tue Jun 30 19:21:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser178Ala;Tyr179Ala]' physical association physical association 2 A, B Both J/Jn and P/Pn fragments of neurofibromin were able to interact with syndecans 1-4 nf1-sdc3 5 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2 A Both J/Jn and P/Pn fragments of neurofibromin were able to interact with syndecans 1-4 nf1-sdc4 5 11 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2 A Both J/Jn and P/Pn fragments of neurofibromin were able to interact with syndecans 1-4 nf1-sdc2-3 3 8 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1 A By yeast two-hybrid assays either Jn (aa 1357-1473) or Pn (aa 2619-2719) regions of neurofibromin were sufficient to interact with syndecan-2 THe sequence of human syndecan-2 stated by the authors to interact with neurofibromin ends at residue 211. However, the sequence in the UniprotKB (P34741) is only 201 residues in length. nf1-sdc2-4 5 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1 A By yeast two-hybrid assays either Jn (aa 1357-1473) or Pn (aa 2619-2719) regions of neurofibromin were sufficient to interact with syndecan-2 nf1-sdc1-1 5 6 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2 A Both J/Jn and P/Pn fragments of neurofibromin were able to interact with syndecans 1-4 nf1-sdc2-5 5 10 unspecified role unspecified role prey prey c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain P34900:p.[Arg172Ala;Lys173Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain K A Wed May 02 15:39:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg172ala,lys173ala' Tue Jun 30 18:51:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg172Ala;Lys173Ala]' P34900:p.[Lys174Ala;Asp175Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain D A Wed May 02 20:22:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys174ala,asp175ala' Tue Jun 30 18:23:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys174Ala;Asp175Ala]' P34900:p.[Glu176Ala;Gly177Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain G A Wed May 02 18:47:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu176ala,gly177ala' Tue Jun 30 19:36:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu176Ala;Gly177Ala]' P34900:p.[Ser178Ala;Tyr179Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 19:39:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser178ala,tyr179ala' Tue Jun 30 18:15:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser178Ala;Tyr179Ala]' 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2 A, B Both J/Jn and P/Pn fragments of neurofibromin were able to interact with syndecans 1-4 nf1-sdc3-1 5 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2 A Both J/Jn and P/Pn fragments of neurofibromin were able to interact with syndecans 1-4 nf1-sdc4-1 5 11 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2 A Both J/Jn and P/Pn fragments of neurofibromin were able to interact with syndecans 1-4 nf1-sdc3-2 2 7 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association 3 D Neurofibromin antibodies precipitated over 50% of neurofibromin from Triton X-100- solubilized rat brain and coprecipitated about 5-10% of syndecan-3. In addition, a small fraction of CASK was coimmunoprecipitated by neurofibromin antibody This indicates that there is a native complex made up of neurofibromin, syndecan-3 and CASK. nf1-sdc3-3 1 7 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization 6 A neurofibromin colocalized with syndecan-3 in axonal pathways such as the corpus callosum nf1-sdc2-6 1 7 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization 6 B Neurofibromin also codistributed with syndecan-2 in synapses in the mossy fiber tract of the hippocampus