UniProt UniProt http://www.uniprot.org A PDZ protein regulates the distribution of the transmembrane semaphorin, M-SemF. A PDZ protein regulates the distribution of the transmembrane semaphorin, M-SemF. J. Biol. Chem. (0021-9258) 1999 imex curation Wang LH., Kalb RG., Strittmatter SM. Synapse - Interactions of proteins with an established role in the presynapse. stephen.strittmatter@yale.edu mouse E17 cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wang LH., Kalb RG., Strittmatter SM. Synapse - Interactions of proteins with an established role in the presynapse. stephen.strittmatter@yale.edu Accepted 2006-SEP-26 by JYOTI. mouse E17 cDNA J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation A PDZ protein regulates the distribution of the transmembrane semaphorin, M-SemF. A PDZ protein regulates the distribution of the transmembrane semaphorin, M-SemF. J. Biol. Chem. (0021-9258) 1999 imex curation Wang LH., Kalb RG., Strittmatter SM. Synapse - Interactions of proteins with an established role in the presynapse. stephen.strittmatter@yale.edu mouse E17 cDNA Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Wang LH., Kalb RG., Strittmatter SM. Synapse - Interactions of proteins with an established role in the presynapse. stephen.strittmatter@yale.edu Accepted 2006-SEP-26 by JYOTI. mouse E17 cDNA J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation A PDZ protein regulates the distribution of the transmembrane semaphorin, M-SemF. A PDZ protein regulates the distribution of the transmembrane semaphorin, M-SemF. J. Biol. Chem. (0021-9258) 1999 imex curation Wang LH., Kalb RG., Strittmatter SM. Synapse - Interactions of proteins with an established role in the presynapse. stephen.strittmatter@yale.edu mouse E17 cDNA Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy antibody detection identification by antibody antibody detection Wang LH., Kalb RG., Strittmatter SM. Synapse - Interactions of proteins with an established role in the presynapse. 293T cells have been transfected with Semac4 and Gipc1. stephen.strittmatter@yale.edu Accepted 2006-SEP-26 by JYOTI. mouse E17 cDNA J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation A PDZ protein regulates the distribution of the transmembrane semaphorin, M-SemF. A PDZ protein regulates the distribution of the transmembrane semaphorin, M-SemF. J. Biol. Chem. (0021-9258) 1999 imex curation Wang LH., Kalb RG., Strittmatter SM. Synapse - Interactions of proteins with an established role in the presynapse. stephen.strittmatter@yale.edu mouse E17 cDNA Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang LH., Kalb RG., Strittmatter SM. Synapse - Interactions of proteins with an established role in the presynapse. 293T cells have been transfected with Semac4 and Gipc1. stephen.strittmatter@yale.edu Accepted 2006-SEP-26 by JYOTI. mouse E17 cDNA J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation A PDZ protein regulates the distribution of the transmembrane semaphorin, M-SemF. A PDZ protein regulates the distribution of the transmembrane semaphorin, M-SemF. J. Biol. Chem. (0021-9258) 1999 imex curation Wang LH., Kalb RG., Strittmatter SM. Synapse - Interactions of proteins with an established role in the presynapse. stephen.strittmatter@yale.edu mouse E17 cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wang LH., Kalb RG., Strittmatter SM. Synapse - Interactions of proteins with an established role in the presynapse. stephen.strittmatter@yale.edu Accepted 2006-SEP-26 by JYOTI. mouse E17 cDNA J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation A PDZ protein regulates the distribution of the transmembrane semaphorin, M-SemF. A PDZ protein regulates the distribution of the transmembrane semaphorin, M-SemF. J. Biol. Chem. (0021-9258) 1999 imex curation Wang LH., Kalb RG., Strittmatter SM. Synapse - Interactions of proteins with an established role in the presynapse. stephen.strittmatter@yale.edu mouse E17 cDNA Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang LH., Kalb RG., Strittmatter SM. Synapse - Interactions of proteins with an established role in the presynapse. 293T cells have been transfected with Semac4 and Gipc1. stephen.strittmatter@yale.edu Accepted 2006-SEP-26 by JYOTI. mouse E17 cDNA J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation gipc2_mouse PDZ domain-containing protein GIPC2 SemaF cytoplasmic domain-associated protein 2 Gipc2 Semcap2 protein protein mouse Mus musculus Mouse MPLGLRGKKKAAKSKEAARLVEGERSSGSQGVPGPPAPARKLVFHAQLAHGSATGRVEDFSSISELYAKIAGVFEIAPSEILFCTLNTPKIDMGKLLGGQLGLEDFIFAHVKGTKKEVNVYKSEDSLGLTITDNGVGYAFIKRIKDGSTIDSVKTICVGDHIECINGENIVGWRHFEVAKKLKELKKEELFTLQLIEPKKAFEIGPRSKAGKTSTEKIGTSRGTLRLRSKGPATVEELPSEAKAKAIGKVDDLLELYMGIRDIDLATTMFEAGKDKSNPDEFAVALDETLGDFAFPDEFLFDVWGAISDMKQGR C73E40AD8DFCF8FA dlg4_rat Disks large homolog 4 Dlg4 Dlgh4 Postsynaptic density protein 95 Synapse-associated protein 90 Psd95 protein protein rat Rattus norvegicus (Rat) Rat MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL DIP protein P31016 original sequence version: 86 DIP protein P31016-1 original sequence version: 148 7922D4E8E0F9AD85 nmde3_rat Glutamate receptor ionotropic, NMDA 2C N-methyl D-aspartate receptor subtype 2C Grin2c Glutamate [NMDA] receptor subunit epsilon-3 protein protein rat Rattus norvegicus (Rat) Rat MGGALGPALLLTSLLGAWARLGAGQGEQAVTVAVVFGSSGPLQTQARTRLTSQNFLDLPLEIQPLTVGVNNTNPSSILTQICGLLGAARVHGIVFEDNVDTEAVAQLLDFVSSQTHVPILSISGGSAVVLTPKEPGSAFLQLGVSLEQQLQVLFKVLEEYDWSAFAVITSLHPGHALFLEGVRAVADASYLSWRLLDVLTLELGPGGPRARTQRLLRQVDAPVLVAYCSREEAEVLFAEAAQAGLVGPGHVWLVPNLALGSTDAPPAAFPVGLISVVTESWRLSLRQKVRDGVAILALGAHSYRRQYGTLPAPAGDCRSHPGPVSPAREAFYRHLLNVTWEGRDFSFSPGGYLVRPTMVVIALNRHRLWEMVGRWDHGVLYMKYPVWPRYSTSLQPVVDSRHLTVATLEERPFVIVESPDPGTGGCVPNTVPCRRQSNHTFSSGDLTPYTKLCCKGFCIDILKKLAKVVKFSYDLYLVTNGKHGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIIDFSVPFVETGISVMVSRSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLTKGKKPGGPSFTIGKSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTVSGLSDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFNQRSVEDALTSLKMGKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDSHWKRAIDLALLQLLGDGETQKLETVWLSGICQNEKNEVMSSKLDIDNMAGVFYMLLVAMGLALLVFAWEHLVYWKLRHSVPNSSQLDFLLAFSRGIYSCFNGVQSLPSPARPPSPDLTADSAQANVLKMLQAARDMVNTADVSSSLDRATRTIENWGNNRRVPAPTASGPRSSTPGPPGQPSPSGWGPPGGGRTPLARRAPQPPARPATCGPPLPDVSRPSCRHASDARWPVRVGHQGPHVSASERRALPERSLLPAHCHYSSFPRAERSGRPYLPLFPEPPEPDDLPLLGPEQLARREAMLRAAWARGPRPRHASLPSSVAEAFTRSNPLPARCTGHACACPCPQSRPSCRHLAQAQSLRLPSYPEACVEGVPAGVATWQPRQHVCLHAHTRLPFCWGTVCRHPPPCTSHSPWLIGTWEPPAHRVRTLGLGTGYRDSGVLEEVSREACGTQGFPRSCTWRRVSSLESEV B175993804B337A4 gipc1_mouse PDZ domain-containing protein GIPC1 Gipc1 Gipc Semcap1 RGS19-interacting protein 1 GAIP C-terminus-interacting protein RGS-GAIP-interacting protein Synectin SemaF cytoplasmic domain-associated protein 1 Rgs19ip1 protein protein mouse Mus musculus Mouse MPLGLGRRKKAPPLVENEEAEPSRSGLGVGEPGPLGGSAAGESQMGLPPPPAALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPAAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEEALGLTITDNGAGYAFIKRIKEGSVIDHIQLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKAFDMISQRSAGGHPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRDTELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVGRY DIP protein Q9Z0G0 original sequence version: 114 52E5ED6092EA9300 sem4b_mouse Semaphorin-4B Semaphorin-C Sema4b Kiaa1745 Semac SemC protein protein mouse Mus musculus Mouse MGRASRSAVLRRALLLLLLLLLLRTTTTRALGPRISVPLGSEERLIRKFEAENISNYTALLLSQDGKTLYVGAREALFALNSNLSFLPGGEYQELLWSADADRKQQCSFKGKDPKRDCQNYIKILLPLNSSHLLTCGTAAFSPLCAYIHIASFTLAQDEAGNVILEDGKGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSSRPTKTESSLNWLQDPAFVASAYVPESLGSPIGDDDKIYFFFSETGQEFEFFENTIVSRVARVCKGDEGGERVLQQRWTSFLKAQLLCSRPDDGFPFNVLQDVFTLNPNPQDWRKTLFYGVFTSQWHRGTTEGSAICVFTMNDVQKAFDGLYKKVNRETQQWYTETHQVPTPRPGACITNSARERKINSSLQLPDRVLNFLKDHFLMDGQVRSRLLLLQPRARYQRVAVHRVPGLHSTYDVLFLGTGDGRLHKAVTLSSRVHIIEELQIFPQGQPVQNLLLDSHGGLLYASSHSGVVQVPVANCSLYPTCGDCLLARDPYCAWTGSACRLASLYQPDLASRPWTQDIEGASVKELCKNSSYKARFLVPGKPCKQVQIQPNTVNTLACPLLSNLATRLWVHNGAPVNASASCRVLPTGDLLLVGSQQGLGVFQCWSIEEGFQQLVASYCPEVMEEGVMDQKNQRDGTPVIINTSRVSAPAGGRASWGADKSYWNEFLVMCTLFVFAMVLLFLFFLYRHRDGMKLFLKQGECASVHPKTRPIVLPPETRPLNGVGPPSTPLDHRGYQALSDSSPGPRVFTESEKRPLSIQDSFVEVSPVCPRPRVRLGSEIRDSVV 051589B4DFAE9883 rgs19_mouse Regulator of G-protein signaling 19 Rgs19 protein protein mouse Mus musculus Mouse MPTPHEAEKQHTGPEEADRPPSMSSHDAAPSGPPSRNPCCLCWCCCCSCSWNQERQRAWQVSRESKLQPLPSCEVCTPPSPKEVQSWAQSFDKLMHSPTGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINRKMQEPSPHTFDDAQLQIYTLMHRDSYPRFLTSPTYRSLLLQGAPQSSEA 4F166A6607184F31 sem4c_mouse Semaphorin-4C Semaphorin-C-like 1 M-Sema F Sema4c Semacl1 Semai S4c protein protein mouse Mus musculus Mouse MAPHWAVWLLAAGLWGLGIGAEMWWNLVPRKTVSSGELVTVVRRFSQTGIQDFLTLTLTEHSGLLYVGAREALFAFSVEALELQGAISWEAPAEKKIECTQKGKSNQTECFNFIRFLQPYNSSHLYVCGTYAFQPKCTYINMLTFTLDRAEFEDGKGKCPYDPAKGHTGLLVDGELYSATLNNFLGTEPVILRYMGTHHSIKTEYLAFWLNEPHFVGSAFVPESVGSFTGDDDKIYFFFSERAVEYDCYSEQVVARVARVCKGDMGGARTLQKKWTTFLKARLVCSAPDWKVYFNQLKAVHTLRGASWHNTTFFGVFQARWGDMDLSAVCEYQLEQIQQVFEGPYKEYSEQAQKWARYTDPVPSPRPGSCINNWHRDNGYTSSLELPDNTLNFIKKHPLMEDQVKPRLGRPLLVKKNTNFTHVVADRVPGLDGATYTVLFIGTGDGWLLKAVSLGPWIHMVEELQVFDQEPVESLVLSQSKKVLFAGSRSQLVQLSLADCTKYRFCVDCVLARDPYCAWNVNTSRCVATTSGRSGSFLVQHVANLDTSKMCNQYGIKKVRSIPKNITVVSGTDLVLPCHLSSNLAHAHWTFGSQDLPAEQPGSFLYDTGLQALVVMAAQSRHSGPYRCYSEEQGTRLAAESYLVAVVAGSSVTLEARAPLENLGLVWLAVVALGAVCLVLLLLVLSLRRRLREELEKGAKASERTLVYPLELPKEPASPPFRPGPETDEKLWDPVGYYYSDGSLKIVPGHARCQPGGGPPSPPPGIPGQPLPSPTRLHLGGGRNSNANGYVRLQLGGEDRGGSGHPLPELADELRRKLQQRQPLPDSNPEESSV 6868BB5BF571482D sema4c-gipc1-1 1 13 unspecified role unspecified role bait bait cytoplasmic region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 1A sema4c-gipc2-1 5 13 unspecified role unspecified role bait bait cytoplasmic region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 1A and 4B gipc2-sema4c-2 5 13 unspecified role unspecified role prey prey cytoplasmic region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 1A gpc1-sema4c-2 5 13 unspecified role unspecified role prey prey cytoplasmic region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 1A sema4c-gipc1-2 2 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q64151:p.Ser832Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:08:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser832ala' Tue Jun 30 18:54:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser832Ala' Q64151:p.Ser832Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S D Wed May 02 19:35:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser832asp' Tue Jun 30 17:20:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser832Asp' Q64151:p.Ser832_Val834del mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain SSV ... Wed May 02 18:41:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser_ser_val832-834del_del_del' Tue Jun 30 15:36:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser832_Val834del' ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 4A Lysates from human 293T cells transfected with GIPC1 have been used sema4c-gipc1-3 5 13 unspecified role unspecified role bait bait cytoplasmic region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 4B sema4b-gipc1-1 5 11 unspecified role unspecified role bait bait cytoplasmic region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 4B Only weak interaction has been found. sema4b-gipc2-1 5 7 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 11 unspecified role unspecified role bait bait cytoplasmic region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 4B Only weak interaction has been found. dlg4-grinc2-1 5 9 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Only weak interaction has been found. 4B rgs19-gipc1-1 5 12 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Weak interaction has been found. 4C rgs19-gipc1-2 5 12 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Weak interaction has been found. 4C sema4c-gipc1-4 2 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q64151:p.Ser832_Val834del mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain SSV ... Wed May 02 20:33:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser_ser_val832-834del_del_del' Tue Jun 30 17:05:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser832_Val834del' ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5A Mouse brain lysate prepared from GIPC1 transfected cells has been used. sema4c-gipc2-4 2 7 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q64151:p.Ser832_Val834del mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain SSV ... Wed May 02 18:59:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser_ser_val832-834del_del_del' Tue Jun 30 16:07:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser832_Val834del' ecoli Escherichia coli (strain K12) physical association physical association 5A Mouse brain lysate prepared from cells transfected with Gipc2 has been used. gipc1-semac4-5 6 13 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 10 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 5B semac4-gipc1-5 4 13 unspecified role unspecified role bait bait human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 5B semac4-gipc1-6 3 13 unspecified role unspecified role neutral component neutral component human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 10 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. colocalization colocalization 5A Sema4c and Gipc1 appear to aggregate to clusters in brain that are resistant to nonionic detergent extraction. The nature of this clusters is not determined.