MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Familial STAG2 germline mutation defines a new human cohesinopathy. Familial STAG2 germline mutation defines a new human cohesinopathy. NPJ genomic medicine 2016 imex curation Soardi FC., Machado-Silva A., Linhares ND., Zheng G., Qu Q., Pena HB., Martins TMM., Vieira HGS., Pereira NB., Melo-Minardi RC., Gomes CC., Gomez RS., Gomes DA., Pires DEV., Ascher DB., Yu H., Pena SDJ., Soardi FC., Machado-Silva A., Linhares ND., Zheng G., Qu Q., Pena HB., Martins TMM., Vieira HGS., Pereira NB., Melo-Minardi RC., Gomes CC., Gomez RS., Gomes DA., Pires DEV., Ascher DB., Yu H., Pena SDJ. Rare diseases - Interactions investigated in the context of Rare genetic disease Hongtao.Yu@utsouthwestern.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down autoradiography autoradiography Soardi FC., Machado-Silva A., Linhares ND., Zheng G., Qu Q., Pena HB., Martins TMM., Vieira HGS., Pereira NB., Melo-Minardi RC., Gomes CC., Gomez RS., Gomes DA., Pires DEV., Ascher DB., Yu H., Pena SDJ., Soardi FC., Machado-Silva A., Linhares ND., Zheng G., Qu Q., Pena HB., Martins TMM., Vieira HGS., Pereira NB., Melo-Minardi RC., Gomes CC., Gomez RS., Gomes DA., Pires DEV., Ascher DB., Yu H., Pena SDJ. Rare diseases - Interactions investigated in the context of Rare genetic disease Hongtao.Yu@utsouthwestern.edu Accepted 2021-JAN-10 AT 06:44 GMT AT 06:44 GMT by LPERFETTO NPJ genomic medicine 2016 Only protein-protein interactions imex curation imex curation Familial STAG2 germline mutation defines a new human cohesinopathy. Familial STAG2 germline mutation defines a new human cohesinopathy. NPJ genomic medicine 2016 imex curation Soardi FC., Machado-Silva A., Linhares ND., Zheng G., Qu Q., Pena HB., Martins TMM., Vieira HGS., Pereira NB., Melo-Minardi RC., Gomes CC., Gomez RS., Gomes DA., Pires DEV., Ascher DB., Yu H., Pena SDJ., Soardi FC., Machado-Silva A., Linhares ND., Zheng G., Qu Q., Pena HB., Martins TMM., Vieira HGS., Pereira NB., Melo-Minardi RC., Gomes CC., Gomez RS., Gomes DA., Pires DEV., Ascher DB., Yu H., Pena SDJ. Rare diseases - Interactions investigated in the context of Rare genetic disease Hongtao.Yu@utsouthwestern.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Soardi FC., Machado-Silva A., Linhares ND., Zheng G., Qu Q., Pena HB., Martins TMM., Vieira HGS., Pereira NB., Melo-Minardi RC., Gomes CC., Gomez RS., Gomes DA., Pires DEV., Ascher DB., Yu H., Pena SDJ., Soardi FC., Machado-Silva A., Linhares ND., Zheng G., Qu Q., Pena HB., Martins TMM., Vieira HGS., Pereira NB., Melo-Minardi RC., Gomes CC., Gomez RS., Gomes DA., Pires DEV., Ascher DB., Yu H., Pena SDJ. Rare diseases - Interactions investigated in the context of Rare genetic disease Hongtao.Yu@utsouthwestern.edu Accepted 2021-JAN-10 AT 06:44 GMT AT 06:44 GMT by LPERFETTO NPJ genomic medicine 2016 Only protein-protein interactions imex curation imex curation Familial STAG2 germline mutation defines a new human cohesinopathy. Familial STAG2 germline mutation defines a new human cohesinopathy. NPJ genomic medicine 2016 imex curation Soardi FC., Machado-Silva A., Linhares ND., Zheng G., Qu Q., Pena HB., Martins TMM., Vieira HGS., Pereira NB., Melo-Minardi RC., Gomes CC., Gomez RS., Gomes DA., Pires DEV., Ascher DB., Yu H., Pena SDJ., Soardi FC., Machado-Silva A., Linhares ND., Zheng G., Qu Q., Pena HB., Martins TMM., Vieira HGS., Pereira NB., Melo-Minardi RC., Gomes CC., Gomez RS., Gomes DA., Pires DEV., Ascher DB., Yu H., Pena SDJ. Rare diseases - Interactions investigated in the context of Rare genetic disease Hongtao.Yu@utsouthwestern.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Soardi FC., Machado-Silva A., Linhares ND., Zheng G., Qu Q., Pena HB., Martins TMM., Vieira HGS., Pereira NB., Melo-Minardi RC., Gomes CC., Gomez RS., Gomes DA., Pires DEV., Ascher DB., Yu H., Pena SDJ., Soardi FC., Machado-Silva A., Linhares ND., Zheng G., Qu Q., Pena HB., Martins TMM., Vieira HGS., Pereira NB., Melo-Minardi RC., Gomes CC., Gomez RS., Gomes DA., Pires DEV., Ascher DB., Yu H., Pena SDJ. Rare diseases - Interactions investigated in the context of Rare genetic disease Hongtao.Yu@utsouthwestern.edu Accepted 2021-JAN-10 AT 06:44 GMT AT 06:44 GMT by LPERFETTO NPJ genomic medicine 2016 Only protein-protein interactions imex curation imex curation rad21_human Double-strand-break repair protein rad21 homolog RAD21 HR21 KIAA0078 Nuclear matrix protein 1 SCC1 homolog NXP1 SCC1 protein protein human Homo sapiens Human MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENREAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFSLNQSRVEEITMREEVGNISILQENDFGDFGMDDREIMREGSAFEDDDMLVSTTTSNLLLESEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGGIFDDPPALSEAGVMLPEQPAHDDMDEDDNVSMGGPDSPDSVDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEFENPEVPREDQQQQHQQRDVIDEPIIEEPSRLQESVMEASRTNIDESAMPPPPPQGVKRKAGQIDPEPVMPPQQVEQMEIPPVELPPEEPPNICQLIPELELLPEKEKEKEKEKEDDEEEEDEDASGGDQDQEERRWNKRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDIIATPGPRFHII DIP protein O60216 original sequence version: 72 DIP protein O60216 original sequence version: 57 DIP protein O60216 original sequence version: 113 DIP protein O60216 original sequence version: 128 DIP protein O60216 original sequence version: 134 7D4A6EA6392BE73D sgo1_human Shugoshin 1 SGO1 SGOL1 Serologically defined breast cancer antigen NY-BR-85 Shugoshin-like 1 protein protein human Homo sapiens Human MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEDQIPTIPQDTLGVDFDSGEAKSTDNVLPRTVSVRSSLKKHCNSICQFDSLDDFETSHLAGKSFEFERVGFLDPLVNMHIPENVQHNACQWSKDQVNLSPKLIQPGTFTKTKEDILESKSEQTKSKQRDTQERKREEKRKANRRKSKRMSKYKENKSENKKTVPQKKMHKSVSSNDAYNFNLEEGVHLTPFRQKVSNDSNREENNESEVSLCESSGSGDDSDDLYLPTCKYIQNPTSNSDRPVTRPLAKRALKYTDEKETEGSKPTKTPTTTPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR DIP protein Q5FBB7 original sequence version: 89 DIP protein Q5FBB7 original sequence version: 64 DIP protein Q5FBB7 original sequence version: 92 DIP protein Q5FBB7 original sequence version: 98 90CEE0FD2B40CD9C wapl_human Wings apart-like protein homolog WAPL FOE Friend of EBNA2 protein KIAA0261 WAPAL WAPL cohesin release factor protein protein human Homo sapiens Human MTSRFGKTYSRKGGNGSSKFDEVFSNKRTTLSTKWGETTFMAKLGQKRPNFKPDIQEIPKKPKVEEESTGDPFGFDSDDESLPVSSKNLAQVKCSSYSESSEAAQLEEVTSVLEANSKISHVVVEDTVVSDKCFPLEDTLLGKEKSTNRIVEDDASISSCNKLITSDKVENFHEEHEKNSHHIHKNADDSTKKPNAETTVASEIKETNDTWNSQFGKRPESPSEISPIKGSVRTGLFEWDNDFEDIRSEDCILSLDSDPLLEMKDDDFKNRLENLNEAIEEDIVQSVLRPTNCRTYCRANKTKSSQGASNFDKLMDGTSQALAKANSESSKDGLNQAKKGGVSCGTSFRGTVGRTRDYTVLHPSCLSVCNVTIQDTMERSMDEFTASTPADLGEAGRLRKKADIATSKTTTRFRPSNTKSKKDVKLEFFGFEDHETGGDEGGSGSSNYKIKYFGFDDLSESEDDEDDDCQVERKTSKKRTKTAPSPSLQPPPESNDNSQDSQSGTNNAENLDFTEDLPGVPESVKKPINKQGDKSKENTRKIFSGPKRSPTKAVYNARHWNHPDSEELPGPPVVKPQSVTVRLSSKEPNQKDDGVFKAPAPPSKVIKTVTIPTQPYQDIVTALKCRREDKELYTVVQHVKHFNDVVEFGENQEFTDDIEYLLSGLKSTQPLNTRCLSVISLATKCAMPSFRMHLRAHGMVAMVFKTLDDSQHHQNLSLCTAALMYILSRDRLNMDLDRASLDLMIRLLELEQDASSAKLLNEKDMNKIKEKIRRLCETVHNKHLDLENITTGHLAMETLLSLTSKRAGDWFKEELRLLGGLDHIVDKVKECVDHLSRDEDEEKLVASLWGAERCLRVLESVTVHNPENQSYLIAYKDSQLIVSSAKALQHCEELIQQYNRAEDSICLADSKPLPHQNVTNHVGKAVEDCMRAIIGVLLNLTNDNEWGSTKTGEQDGLIGTALNCVLQVPKYLPQEQRFDIRVLGLGLLINLVEYSARNRHCLVNMETSCSFDSSICSGEGDDSLRIGGQVHAVQALVQLFLERERAAQLAESKTDELIKDAPTTQHDKSGEWQETSGEIQWVSTEKTDGTEEKHKKEEEDEELDLNKALQHAGKHMEDCIVASYTALLLGCLCQESPINVTTVREYLPEGDFSIMTEMLKKFLSFMNLTCAVGTTGQKSISRVIEYLEHC DIP protein Q7Z5K2 original sequence version: 86 DIP protein Q7Z5K2 original sequence version: 92 A01026E520BFAB2F cdca5_human Sororin Cell division cycle-associated protein 5 p35 CDCA5 protein protein human Homo sapiens Human MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE DIP protein Q96FF9 original sequence version: 69 DIP protein Q96FF9 original sequence version: 98 DIP protein Q96FF9 original sequence version: 82 A4CD6768D3464040 pds5a_human Sister chromatid cohesion protein PDS5 homolog A Sister chromatid cohesion protein 112 Cell proliferation-inducing gene 54 protein PDS5A KIAA0648 PDS5 PIG54 protein protein human Homo sapiens Human MDFTAQPKPATALCGVVSADGKIAYPPGVKEITDKITTDEMIKRLKMVVKTFMDMDQDSEDEKQQYLPLALHLASEFFLRNPNKDVRLLVACCLADIFRIYAPEAPYTSHDKLKDIFLFITRQLKGLEDTKSPQFNRYFYLLENLAWVKSYNICFELEDCNEIFIQLFRTLFSVINNSHNKKVQMHMLDLMSSIIMEGDGVTQELLDSILINLIPAHKNLNKQSFDLAKVLLKRTVQTIEACIANFFNQVLVLGRSSVSDLSEHVFDLIQELFAIDPHLLLSVMPQLEFKLKSNDGEERLAVVRLLAKLFGSKDSDLATQNRPLWQCFLGRFNDIHVPVRLESVKFASHCLMNHPDLAKDLTEYLKVRSHDPEEAIRHDVIVTIITAAKRDLALVNDQLLGFVRERTLDKRWRVRKEAMMGLAQLYKKYCLHGEAGKEAAEKVSWIKDKLLHIYYQNSIDDKLLVEKIFAQYLVPHNLETEERMKCLYYLYASLDPNAVKALNEMWKCQNMLRSHVRELLDLHKQPTSEANCSAMFGKLMTIAKNLPDPGKAQDFVKKFNQVLGDDEKLRSQLELLISPTCSCKQADICVREIARKLANPKQPTNPFLEMVKFLLERIAPVHIDSEAISALVKLMNKSIEGTADDEEEGVSPDTAIRSGLELLKVLSFTHPTSFHSAETYESLLQCLRMEDDKVAEAAIQIFRNTGHKIETDLPQIRSTLIPILHQKAKRGTPHQAKQAVHCIHAIFTNKEVQLAQIFEPLSRSLNADVPEQLITPLVSLGHISMLAPDQFASPMKSVVANFIVKDLLMNDRSTGEKNGKLWSPDEEVSPEVLAKVQAIKLLVRWLLGMKNNQSKSANSTLRLLSAMLVSEGDLTEQKRISKSDMSRLRLAAGSAIMKLAQEPCYHEIITPEQFQLCALVINDECYQVRQIFAQKLHKALVKLLLPLEYMAIFALCAKDPVKERRAHARQCLLKNISIRREYIKQNPMATEKLLSLLPEYVVPYMIHLLAHDPDFTRSQDVDQLRDIKECLWFMLEVLMTKNENNSHAFMKKMAENIKLTRDAQSPDESKTNEKLYTVCDVALCVINSKSALCNADSPKDPVLPMKFFTQPEKDFCNDKSYISEETRVLLLTGKPKPAGVLGAVNKPLSATGRKPYVRSTGTETGSNINVNSELNPSTGNRSREQSSEAAETGVSENEENPVRIISVTPVKNIDPVKNKEINSDQATQGNISSDRGKKRTVTAAGAENIQQKTDEKVDESGPPAPSKPRRGRRPKSESQGNATKNDDLNKPINKGRKRAAVGQESPGGLEAGNAKAPKLQDLAKKAAPAERQIDLQR DIP protein Q29RF7 original sequence version: 81 FA28EA9EF77499D9 stag2_human Cohesin subunit SA-2 STAG2 SA2 Stromal antigen 2 SCC3 homolog 2 protein protein human Homo sapiens Human MIAAPEIPTDFNLLQESETHFSSDTDFEDIEGKNQKQGKGKTCKKGKKGPAEKGKGGNGGGKPPSGPNRMNGHHQQNGVENMMLFEVVKMGKSAMQSVVDDWIESYKHDRDIALLDLINFFIQCSGCKGVVTAEMFRHMQNSEIIRKMTEEFDEDSGDYPLTMAGPQWKKFKSSFCEFIGVLVRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNLSINMDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNAIFKGVFVHRYRDAIAEIRAICIEEIGIWMKMYSDAFLNDSYLKYVGWTMHDKQGEVRLKCLTALQGLYYNKELNSKLELFTSRFKDRIVSMTLDKEYDVAVQAIKLLTLVLQSSEEVLTAEDCENVYHLVYSAHRPVAVAAGEFLYKKLFSRRDPEEDGMMKRRGRQGPNANLVKTLVFFFLESELHEHAAYLVDSMWDCATELLKDWECMNSLLLEEPLSGEEALTDRQESALIEIMLCTIRQAAECHPPVGRGTGKRVLTAKEKKTQLDDRTKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRNIVEKHTDTDVLEACSKTYHALCNEEFTIFNRVDISRSQLIDELADKFNRLLEDFLQEGEEPDEDDAYQVLSTLKRITAFHNAHDLSKWDLFACNYKLLKTGIENGDMPEQIVIHALQCTHYVILWQLAKITESSSTKEDLLRLKKQMRVFCQICQHYLTNVNTTVKEQAFTILCDILMIFSHQIMSGGRDMLEPLVYTPDSSLQSELLSFILDHVFIEQDDDNNSADGQQEDEASKIEALHKRRNLLAAFCKLIVYTVVEMNTAADIFKQYMKYYNDYGDIIKETMSKTRQIDKIQCAKTLILSLQQLFNEMIQENGYNFDRSSSTFSGIKELARRFALTFGLDQLKTREAIAMLHKDGIEFAFKEPNPQGESHPPLNLAFLDILSEFSSKLLRQDKRTVYVYLEKFMTFQMSLRREDVWLPLMSYRNSLLAGGDDDTMSVISGISSRGSTVRSKKSKPSTGKRKVVEGMQLSLTEESSSSDSMWLSREQTLHTPVMMQTPQLTSTIMREPKRLRPEDSFMSVYPMQTEHHQTPLDYNRRGTSLMEDDEEPIVEDVMMSSEGRIEDLNEGMDFDTMDIDLPPSKNRRERTELKPDFFDPASIMDESVLGVSMF DIP protein Q8N3U4 original sequence version: 61 DIP protein Q8N3U4 original sequence version: 104 DIP protein Q8N3U4 original sequence version: 117 DIP protein Q8N3U4 original sequence version: 123 692358EFFFF61BB9 smc3_human Structural maintenance of chromosomes protein 3 SMC3 BAM SMC3L1 Chondroitin sulfate proteoglycan 6 Chromosome-associated polypeptide Basement membrane-associated chondroitin proteoglycan BMH CSPG6 protein protein human Homo sapiens Human MYIKQVIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEEEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLDELSAKRETSGEKSRQLRDAQQDARDKMEDIERQVRELKTKISAMKEEKEQLSAERQEQIKQRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELAETEPKFNSVKEKEERGIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAIHKDLEDTEANKEKNLEQYNKLDQDLNEVKARVEELDRKYYEVKNKKDELQSERNYLWREENAEQQALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLDHFRRKGINQHVQNGYHGIVMNNFECEPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDVRKAEEELGELEAKLNENLRRNIERINNEIDQLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLEDQKRVDALNDEIRQLQQENRQLLNERIKLEGIITRVETYLNENLRKRLDQVEQELNELRETEGGTVLTATTSELEAINKRVKDTMARSEDLDNSIDKTEAGIKELQKSMERWKNMEKEHMDAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLSLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTHG DIP protein Q9UQE7 original sequence version: 75 DIP protein Q9UQE7 original sequence version: 54 DIP protein Q9UQE7 original sequence version: 121 DIP protein Q9UQE7 original sequence version: 97 DIP protein Q9UQE7 original sequence version: 137 DIP protein Q9UQE7 original sequence version: 120 21EF9A08A5D8096A smc1a_human Structural maintenance of chromosomes protein 1A SMC1A DXS423E KIAA0178 SB1.8 SMC1 SMC1L1 Sb1.8 protein protein human Homo sapiens Human MGFLKLIEIENFKSYKGRQIIGPFQRFTAIIGPNGSGKSNLMDAISFVLGEKTSNLRVKTLRDLIHGAPVGKPAANRAFVSMVYSEEGAEDRTFARVIVGGSSEYKINNKVVQLHEYSEELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDKRKKEMVKAEEDTQFNYHRKKNIAAERKEAKQEKEEADRYQRLKDEVVRAQVQLQLFKLYHNEVEIEKLNKELASKNKEIEKDKKRMDKVEDELKEKKKELGKMMREQQQIEKEIKEKDSELNQKRPQYIKAKENTSHKIKKLEAAKKSLQNAQKHYKKRKGDMDELEKEMLSVEKARQEFEERMEEESQSQGRDLTLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEMAKRRIDEINKELNQVMEQLGDARIDRQESSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELKGAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVALDGTLFQKSGVISGGASDLKAKARRWDEKAVDKLKEKKERLTEELKEQMKAKRKEAELRQVQSQAHGLQMRLKYSQSDLEQTKTRHLALNLQEKSKLESELANFGPRINDIKRIIQSREREMKDLKEKMNQVEDEVFEEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDFEKNQLKEDQDKVHMWEQTVKKDENEIEKLKKEEQRHMKIIDETMAQLQDLKNQHLAKKSEVNDKNHEMEEIRKKLGGANKEMTHLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLSKGTMDDISQEEGSSQGEDSVSGSQRISSIYAREALIEIDYGDLCEDLKDAQAEEEIKQEMNTLQQKLNEQQSVLQRIAAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQIKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKEQSTCNFQAIVISLKEEFYTKAESLIGVYPEQGDCVISKVLTFDLTKYPDANPNPNEQ DIP protein Q14683 original sequence version: 112 DIP protein Q14683 original sequence version: 149 DIP protein Q14683 original sequence version: 133 E0A44CA7476C88A6 stag2-1 1 6 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Q8N3U4:p.Ser327Asn mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S N Mon Mar 01 11:40:02 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q8N3U4:p.[Ser327Asn]' Q8N3U4:p.Lys330Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K E Mon Mar 01 10:58:23 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q8N3U4:p.[Lys330Glu]' myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association F6B F6C sgo1-stag2-2 1 5 unspecified role unspecified role bait bait purified purified Q5FBB7:p.Thr346Glu mutation mutation certain certain sequence position certain certain certain sequence position certain T E Mon Mar 01 11:02:06 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q5FBB7:p.[Thr346Glu ]' GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Q8N3U4:p.Ser327Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S N Mon Mar 01 10:46:19 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q8N3U4:p.[Ser327Asn]' Q8N3U4:p.Lys330Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K E Mon Mar 01 11:08:26 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q8N3U4:p.[Lys330Glu]' myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association F6B F6C sgo1-stag2-3 3 5 unspecified role unspecified role neutral component neutral component purified purified binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain phosres phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component purified purified binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component purified purified Q8N3U4:p.Ser327Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S N Mon Mar 01 11:04:57 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q8N3U4:p.[Ser327Asn]' binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association F6D wapl-stag2-1 1 4 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated Q8N3U4:p.Ser327Asn mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S N Mon Mar 01 11:27:10 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q8N3U4:p.[Ser327Asn]' GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association F7C cdca5-1 2 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q8N3U4:p.Ser327Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S N Mon Mar 01 11:40:55 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q8N3U4:p.[Ser327Asn]' Q8N3U4:p.Asp793Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D K Mon Mar 01 10:45:32 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q8N3U4:p.[Asp793Lys]' association association F7A stag2-cdca5-1 2 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q8N3U4:p.Ser327Asn mutation mutation certain certain sequence position certain certain certain sequence position certain S N Mon Mar 01 11:17:05 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q8N3U4:p.[Ser327Asn]' association association F7A