IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification and functional characterization of two missense mutations in NDRG1 associated with Charcot-Marie-Tooth disease type 4D. Identification and functional characterization of two missense mutations in NDRG1 associated with Charcot-Marie-Tooth disease type 4D. Human mutation 2017 imex curation Li LX., Liu GL., Liu ZJ., Lu C., Wu ZY. Rare diseases - Interactions investigated in the context of Rare genetic disease zhiyingwu@zju.edu.cn 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Li LX., Liu GL., Liu ZJ., Lu C., Wu ZY. Rare diseases - Interactions investigated in the context of Rare genetic disease zhiyingwu@zju.edu.cn Accepted 2019-OCT-10 AT 08:58 BST AT 08:58 BST by LIVIAP Human mutation 2017 Only protein-protein interactions imex curation imex curation Identification and functional characterization of two missense mutations in NDRG1 associated with Charcot-Marie-Tooth disease type 4D. Identification and functional characterization of two missense mutations in NDRG1 associated with Charcot-Marie-Tooth disease type 4D. Human mutation 2017 imex curation Li LX., Liu GL., Liu ZJ., Lu C., Wu ZY. Rare diseases - Interactions investigated in the context of Rare genetic disease zhiyingwu@zju.edu.cn 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li LX., Liu GL., Liu ZJ., Lu C., Wu ZY. Rare diseases - Interactions investigated in the context of Rare genetic disease zhiyingwu@zju.edu.cn Accepted 2019-OCT-10 AT 08:58 BST AT 08:58 BST by LIVIAP Human mutation 2017 Only protein-protein interactions imex curation imex curation ndrg1_human Protein NDRG1 N-myc downstream-regulated gene 1 protein Differentiation-related gene 1 protein Reducing agents and tunicamycin-responsive protein Nickel-specific induction protein Cap43 Rit42 NDRG1 CAP43 DRG1 RTP protein protein human Homo sapiens Human MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC 4C816B9C85E3756F rab4a_human Ras-related protein Rab-4A RAB4A RAB4 protein protein human Homo sapiens Human MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC DIP protein P20338 original sequence version: 151 983D65E1162741B0 ndrg1-rab4a-1 1 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q92597:p.Leu146Pro mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L P Tue Jun 30 18:49:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu146Pro' region p.Arg148Ter required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain RFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC Q92597:p.Arg234Gln mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R Q Tue Jun 30 18:35:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg234Gln' 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region mcherry mcherry fluorescent protein tag mcherry undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Figure 3a ndrg1-rab4a-2 2 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q92597:p.Leu146Pro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L P Tue Jun 30 18:42:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu146Pro' region p.Arg148Ter required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain RFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q92597:p.Arg234Gln mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R Q Tue Jun 30 18:55:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg234Gln' 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association FIGURE 3b