IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The CFTR trafficking mutation F508del inhibits the constitutive activity of SLC26A9. The CFTR trafficking mutation F508del inhibits the constitutive activity of SLC26A9. American journal of physiology. Lung cellular and molecular physiology 2017 imex curation Bertrand CA., Mitra S., Mishra SK., Wang X., Zhao Y., Pilewski JM., Madden DR., Frizzell RA. Rare diseases - Interactions investigated in the context of Rare genetic disease cbertra@pitt.edu 05-Jan-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy immunostaining immunostaining Bertrand CA., Mitra S., Mishra SK., Wang X., Zhao Y., Pilewski JM., Madden DR., Frizzell RA. Rare diseases - Interactions investigated in the context of Rare genetic disease cbertra@pitt.edu Accepted 2020-NOV-11 AT 09:15 GMT AT 09:15 GMT by MGT American journal of physiology. Lung cellular and molecular physiology 2017 Only protein-protein interactions imex curation imex curation The CFTR trafficking mutation F508del inhibits the constitutive activity of SLC26A9. The CFTR trafficking mutation F508del inhibits the constitutive activity of SLC26A9. American journal of physiology. Lung cellular and molecular physiology 2017 imex curation Bertrand CA., Mitra S., Mishra SK., Wang X., Zhao Y., Pilewski JM., Madden DR., Frizzell RA. Rare diseases - Interactions investigated in the context of Rare genetic disease cbertra@pitt.edu 05-Jan-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Bertrand CA., Mitra S., Mishra SK., Wang X., Zhao Y., Pilewski JM., Madden DR., Frizzell RA. Rare diseases - Interactions investigated in the context of Rare genetic disease Details on reporter peptide fluorescein labelling, ranges of PDZ1, PDZ2 domains of NHERF-1 and -2 and PDZ domain of CAL were captured from referenced pmid:18754678 and 21105033. Origin of NHERF1, NHERF2 and CAL were found to be of human from pmid:18754678 cbertra@pitt.edu Accepted 2020-NOV-11 AT 09:15 GMT AT 09:15 GMT by MGT American journal of physiology. Lung cellular and molecular physiology 2017 Only protein-protein interactions imex curation imex curation The CFTR trafficking mutation F508del inhibits the constitutive activity of SLC26A9. The CFTR trafficking mutation F508del inhibits the constitutive activity of SLC26A9. American journal of physiology. Lung cellular and molecular physiology 2017 imex curation Bertrand CA., Mitra S., Mishra SK., Wang X., Zhao Y., Pilewski JM., Madden DR., Frizzell RA. Rare diseases - Interactions investigated in the context of Rare genetic disease cbertra@pitt.edu 05-Jan-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bertrand CA., Mitra S., Mishra SK., Wang X., Zhao Y., Pilewski JM., Madden DR., Frizzell RA. Rare diseases - Interactions investigated in the context of Rare genetic disease CFTR construct was found to be of human origin (18556464) cbertra@pitt.edu Accepted 2020-NOV-11 AT 09:15 GMT AT 09:15 GMT by MGT American journal of physiology. Lung cellular and molecular physiology 2017 Only protein-protein interactions imex curation imex curation cftr_human Cystic fibrosis transmembrane conductance regulator CFTR ABCC7 cAMP-dependent chloride channel ATP-binding cassette sub-family C member 7 Channel conductance-controlling ATPase protein protein human Homo sapiens Human MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRELASKKNPKLINALRRCFFWRFMFYGIFLYLGEVTKAVQPLLLGRIIASYDPDNKEERSIAIYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVALLMGLIWELLQASAFCGLGFLIVLALFQAGLGRMMMKYRDQRAGKISERLVITSEMIENIQSVKAYCWEEAMEKMIENLRQTELKLTRKAAYVRYFNSSAFFFSGFFVVFLSVLPYALIKGIILRKIFTTISFCIVLRMAVTRQFPWAVQTWYDSLGAINKIQDFLQKQEYKTLEYNLTTTEVVMENVTAFWEEGFGELFEKAKQNNNNRKTSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETLHRFSLEGDAPVSWTETKKQSFKQTGEFGEKRKNSILNPINSIRKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVLNLMTHSVNQGQNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDLKECFFDDMESIPAVTTWNTYLRYITVHKSLIFVLIWCLVIFLAEVAASLVVLWLLGNTPLQDKGNSTHSRNNSYAVIITSTSSYYVFYIYVGVADTLLAMGFFRGLPLVHTLITVSKILHHKMLHSVLQAPMSTLNTLKAGGILNRFSKDIAILDDLLPLTIFDFIQLLLIVIGAIAVVAVLQPYIFVATVPVIVAFIMLRAYFLQTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRIEMIFVIFFIAVTFISILTTGEGEGRVGIILTLAMNIMSTLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEGKPTKSTKPYKNGQLSKVMIIENSHVKKDDIWPSGGQMTVKDLTAKYTEGGNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRLLNTEGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPVTYQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLVIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRL 8D082AA2E768C065 q7lbe3-1 Solute carrier family 26 member 9 SLC26A9 Anion transporter/exchanger protein 9 protein protein human Homo sapiens Human MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRCSSAKIKAVVFGLLPVLSWLPKYKIKDYIIPDLLGGLSGGSIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGVHQMVPGTFAVISILVGNICLQLAPESKFQVFNNATNESYVDTAAMEAERLHVSATLACLTAIIQMGLGFMQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTIPSYTGPGSIVFTFIDICKNLPHTNIASLIFALISGAFLVLVKELNARYMHKIRFPIPTEMIVVVVATAISGGCKMPKKYHMQIVGEIQRGFPTPVSPVVSQWKDMIGTAFSLAIVSYVINLAMGRTLANKHGYDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITMLVLGIYLYPLPKSVLGALIAVNLKNSLKQLTDPYYLWRKSKLDCCIWVVSFLSSFFLSLPYGVAVGVAFSVLVVVFQTQFRNGYALAQVMDTDIYVNPKTYNRAQDIQGIKIITYCSPLYFANSEIFRQKVIAKTGMDPQKVLLAKQKYLKKQEKRRMRPTQQRRSLFMKTKTVSLQELQQDFENAPPTDPNNNQTPANGTSVSYITFSPDSSSPAQSEPPASAEAPGEPSDMLASVPPFVTFHTLILDMSGVSFVDLMGIKALAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGSLECKHVFPSIHDAVLFAQANARDVTPGHNFQGAPGDAELSLYDSEEDIRSYWDLEQEMFGSMFHAETLTAL DC651F4E8DF2BF77 nhrf1_human Na(+)/H(+) exchange regulatory cofactor NHE-RF1 SLC9A3R1 NHERF NHERF1 Ezrin-radixin-moesin-binding phosphoprotein 50 Regulatory cofactor of Na(+)/H(+) exchanger Sodium-hydrogen exchanger regulatory factor 1 Solute carrier family 9 isoform A3 regulatory factor 1 protein protein human Homo sapiens Human MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQLQKLGVQVREELLRAQEAPGQAEPPAAAEVQGAGNENEPREADKSHPEQRELRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKCRVIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALESPRPALVRSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAHQKRSSKRAPQMDWSKKNELFSNL E33AF87016D37A65 s26a9_human Solute carrier family 26 member 9 SLC26A9 Anion transporter/exchanger protein 9 protein protein human Homo sapiens Human MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRCSSAKIKAVVFGLLPVLSWLPKYKIKDYIIPDLLGGLSGGSIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGVHQMVPGTFAVISILVGNICLQLAPESKFQVFNNATNESYVDTAAMEAERLHVSATLACLTAIIQMGLGFMQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTIPSYTGPGSIVFTFIDICKNLPHTNIASLIFALISGAFLVLVKELNARYMHKIRFPIPTEMIVVVVATAISGGCKMPKKYHMQIVGEIQRGFPTPVSPVVSQWKDMIGTAFSLAIVSYVINLAMGRTLANKHGYDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITMLVLGIYLYPLPKSVLGALIAVNLKNSLKQLTDPYYLWRKSKLDCCIWVVSFLSSFFLSLPYGVAVGVAFSVLVVVFQTQFRNGYALAQVMDTDIYVNPKTYNRAQDIQGIKIITYCSPLYFANSEIFRQKVIAKTGMDPQKVLLAKQKYLKKQEKRRMRPTQQRRSLFMKTKTVSLQELQQDFENAPPTDPNNNQTPANGTSVSYITFSPDSSSPAQSEPPASAEAPGEPSDMLASVPPFVTFHTLILDMSGVSFVDLMGIKALAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGSLECKHVFPSIHDAVLFAQANARDVTPGHNFQGAPGDAELSLYDSEEDIRSYWDLEQEMFGSMFHAETLTAL DC651F4E8DF2BF77 gopc_human Golgi-associated PDZ and coiled-coil motif-containing protein CAL FIG GOPC PDZ protein interacting specifically with TC10 CFTR-associated ligand Fused in glioblastoma protein protein human Homo sapiens Human MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVHDQLLQLHSIQLQLHAKTGQSADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY 8A19DDC376DCD0F4 nhrf2_human Na(+)/H(+) exchange regulatory cofactor NHE-RF2 SLC9A3R2 NHERF2 Tyrosine kinase activator protein 1 SRY-interacting protein 1 Solute carrier family 9 isoform A3 regulatory factor 2 NHE3 kinase A regulatory protein E3KARP Sodium-hydrogen exchanger regulatory factor 2 protein protein human Homo sapiens Human MAAPEPLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVDPETDEHFKRLRVTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSDLPGSDKDTEDGSAWKQDPFQESGLHLSPTAAEAKEKARAMRVNKRAPQMDWNRKREIFSNF 4F5D341590D22ED7 cal36 CAL36 inhibitor peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ANSRWPTSII cftr-slc26a9-1 3 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region glycores glycosylated residue GlycoRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined observed-ptm observed-ptm observed ptm observed-ptm P13569:p.Phe508del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F . Tue Jun 30 16:18:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe508del' P13569:p.Gly551Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G D Tue Jun 30 16:59:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly551Asp' 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell n-terminal region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 3a/b Both the monomeric and dimeric forms of myc-SLC26A9 are observed in the input and are immunoprecipitated with myc Wild-type CFTR undergoes complex glycosylation (maturation), whereas CFTR-F508del undergoes only core glycosylation; core glycosylated CFTR-F508del was observed to be immunoprecipitated with SLC26A9 cftr-slc9a3r1-8 2 6 unspecified role unspecified role neutral component neutral component purified purified pdz1 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction F*-CFTR6 - NHERF1 PDZ1 domain interaction slc26a9-cftr-1 3 6 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell n-terminal region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig. 4a-c Both the monomeric and dimeric forms of myc-SLC26A9 are observed in the input and are immunoprecipitated with myc cftr-slc26a9-7 1 4 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell P13569:p.Phe508del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F . Tue Jun 30 16:41:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe508del' region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell n-terminal region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization Fig. 5a-d slc26a9-cftr-3 3 8 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell n-terminal region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q7LBE3-1:p.Thr789Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T A Tue Jun 30 15:38:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr789Ala' physical association physical association Fig. 6a-b slc26a9-cftr-2 3 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region glycores glycosylated residue GlycoRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined observed-ptm observed-ptm observed ptm observed-ptm P13569:p.Phe508del mutation mutation certain certain sequence position certain certain certain sequence position certain F . Tue Jun 30 16:12:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe508del' 8 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 6c Wild-type CFTR undergoes complex glycosylation (maturation), whereas CFTR-F508del undergoes only core glycosylation cftr-slc9a3r1-1 2 7 inhibitor inhibitor neutral component neutral component purified purified binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role neutral component neutral component purified purified pdz2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal region fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Table 1 F*-CFTR6 - NHERF1 pdz2 domain interaction/SLC26A9 inhibitor peptide cal36-gopc-1 2 8 unspecified role unspecified role neutral component neutral component purified purified pdz domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified n-terminal region fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction iCAL36 - CAL pdz domain interaction cal36-gopc-2 2 8 unspecified role unspecified role neutral component neutral component purified purified pdz domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified n-terminal region fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 4 inhibitor inhibitor neutral component neutral component purified purified binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Table 1 iCAL36 - CAL pdz domain interaction/CFTR10 inhibitor peptide cal36-gopc-3 2 7 inhibitor inhibitor neutral component neutral component purified purified binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component purified purified pdz domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified n-terminal region fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Table 1 iCAL36 - CAL pdz domain interaction/SLC26A9 inhibitor peptide cftr-slc26a9-6 2 6 unspecified role unspecified role neutral component neutral component purified purified pdz2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal region fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction F*-CFTR6 - NHERF1 pdz2 domain interaction cftr-cftr-2 2 4 inhibitor inhibitor neutral component neutral component purified purified binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role neutral component neutral component purified purified pdz2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal region fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Table 1 F*-CFTR6 - NHERF1 pdz2 domain interaction/CFTR inhibitor peptide cftr-slc9a3r1-9 2 7 inhibitor inhibitor neutral component neutral component purified purified binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role neutral component neutral component purified purified pdz1 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction F*-CFTR6 - NHERF1 PDZ1 domain interaction/SLC26A9 inhibitor peptide Table 1 cftr-slc9a3r1-10 2 4 inhibitor inhibitor neutral component neutral component purified purified binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role neutral component neutral component purified purified pdz1 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction F*-CFTR6 - NHERF1 PDZ1 domain interaction/CFTR inhibitor peptide Table 1 cftr-slc9a3r2-5 2 9 unspecified role unspecified role neutral component neutral component purified purified pdz1 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified n-terminus fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction NHERF2 PDZ1 domain interaction with F*CFTR10 cftr-slc26a9-2 2 7 inhibitor inhibitor neutral component neutral component purified purified binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified pdz1 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified n-terminus fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction NHERF2 PDZ1 domain interaction with F*CFTR10/SLC26A9 inhibitor peptide Table 1 cftr-cftr-3 2 4 inhibitor inhibitor neutral component neutral component purified purified binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified pdz1 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified n-terminus fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction NHERF2 PDZ1 domain interaction with F*CFTR10/ CFTR inhibitor peptide Table 1 cftr-slc9a3r2-6 2 9 unspecified role unspecified role neutral component neutral component purified purified pdz2 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified n-terminus fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction NHERF2 PDZ2 domain interaction with F*CFTR10 cftr-slc26a9-3 2 7 inhibitor inhibitor neutral component neutral component purified purified binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified pdz2 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified n-terminus fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction NHERF2 PDZ2 domain interaction with F*CFTR10/SLC26A9 inhibitor peptide Table 1 cftr-cftr-4 2 4 unspecified role unspecified role neutral component neutral component purified purified n-terminus fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 inhibitor inhibitor neutral component neutral component purified purified binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified pdz2 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction NHERF2 PDZ2 domain interaction with F*CFTR10/CFTR inhibitor peptide Table 1