IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structures of complete RNA polymerase II and its subcomplex, Rpb4/7. Structures of complete RNA polymerase II and its subcomplex, Rpb4/7. J. Biol. Chem. (0021-9258) 2005 Armache KJ., Mitterweger S., Meinhart A., Cramer P. PDBe - Data obtained from the Protein Data Bank Europe in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Armache KJ., Mitterweger S., Meinhart A., Cramer P. PDBe - Data obtained from the Protein Data Bank Europe J. Biol. Chem. (0021-9258) 2005 rpb4_yeast DNA-directed RNA polymerase II subunit RPB4 RPB4 YJL140W J0654 DNA-directed RNA polymerase II 32 kDa polypeptide B32 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKKHLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETVGAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY 72A8A26871B87775 72A8A26871B87775 rpb7_yeast DNA-directed RNA polymerase II subunit RPB7 RPB7 YDR404C D9509.22 B16 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI 44C85603A93CDE67 44C85603A93CDE67 rpb4-rpb7-1 1 2 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction tetrameric, multimeric 2.3A